SupplementaryMaterialsfor2020/03/15 · SupplementaryMaterialsfor...

Supplementary Materials for

Blood single cell immune profiling reveals the interferon-MAPK pathway mediated adaptive

immune response for COVID-19

Lulin Huang1,2,3*, Yi Shi1,2,3*, Bo Gong1,2,3*, Li Jiang1,2*, Xiaoqi Liu1,2,3, Jialiang Yang1,2, Juan Tang4,

Chunfang You4, Qi Jiang5, Bo Long5, Tao Zeng6, Mei Luo6, Fanwei Zeng7, Fanxin Zeng7, Shuqiang

Wang8, Xingxiang Yang8, Zhenglin Yang1,2,3, #

#Correspondence should be addressed to: Zhenglin Yang, Email: [email protected] (Z.Y).

This PDF file includes:

Materials and Methods

Figs. S1 to S15

Tables S1 to S10

Other Supplementary Material for this manuscript includes the following:

External Databases S1-4

All sequencing data will be deposited to public database and can be accessed online through a web

portal.

Materials and Methods

Sample collection

For single cell analysis, 10 COVID-19 patients were included in this study, and the basic information

of the included samples is shown in Table S1. All ten patients were collected in Sichuan Province.

Among the COVID-19 patients, their onset time is January 2020, and their age is between 20-62 years old, including five

males and five females. Among them, Patient 2, Patient 5 and Patient 10 work or study in Wuhan and return to Sichuan.

Patient 11 worked in Huangmei County, Hubei Province and returned to Sichuan. Patient 9's son-in-law flew from

Wuhan to Sichuan on January 18, 2020, and got in touch with her. The plane of Patient 7 is from Haikou to Chengdu.

The previous flight of the plane was from Wuhan to Haikou. Patient 1 and Patient 3 live in Jiangxi for a long time,

driving from Jiangxi to Sichuan. Patient 4 attend a meeting in Changsha from January 18 to January 21, and then return

to Sichuan. Patient 8 is the local resident population and has never been to Wuhan. The samples were collected between

the 3rd and 23rd day of their course, including one critical case, one server case and six moderate cases, including two

cured patients. CT images of the lungs of these patients are shown in Fig.S1. The study also included three normal people

(Table S1). In order to exclude the immune response of other infectious diseases and basic diseases and find the unique

immune response of patients with 2019-nCoV, we also included one case of influenza A, one case of acute pharyngitis

and one case of cerebral infarction as other controls (Table S1).

Human Blood Samples PBMCs isolation

All experiments using human samples in this study were approved by the Ethics Committee of Sichuan Provincial

People’s Hospital (approval no. 2020(95)). Informed consent was obtained from all donors. Fresh whole blood from

COVID-19 patients, and unrelated controls donors was collected in 2-mL tubes containing ethylene diamine tetraacetic

acid (EDTA). Peripheral blood mononuclear cells (PBMCs) were isolated from whole blood within 8 h of sample

collection by using 15ml tubes with Lympholyte® cell separation media (CEDARLANE) according to the

manufacturer’s instructions. Briefly, each blood sample was diluted with an equal volume of 1X PBS (pH7.4) added into

a 15ml tube, and centrifuged at 800 × g for 20 min at room temperature. Enriched cells were washed with PBS and

centrifuged at 800 × g for 10 min for twice. Cell numbers and viability were measured using a Countess II Automated

Cell Counter (Thermo Fisher Scientific).

Chromium Single Cell V(D)J Libraries Preparation and sequencing

Chromium Single Cell V(D)J libraries were prepared according to the instructions. In brief, GEMs are generated by

combining barcoded Single Cell VDJ 5’ Gel Beads v1.1, a Master Mix with cells, and Partitioning Oil on Chromium

Next GEM Chip G. Immediately following GEM generation, the Gel Bead is dissolved and any co-partitioned cell is

lysed. Incubation of the GEMs produces 10x Barcoded, full-length cDNA from polyadenylated mRNA. GEMs are

broken and pooled after GEM-RT reaction mixtures are recovered. Silane magnetic beads are used to purify the 10x

Barcoded first-strand cDNA from the post GEM-RT reaction mixture, which includes leftover biochemical reagents and

primers. After cleanup a user may decide to pursue target enrichment directly from firststrand cDNA, in which case,

consult Demonstrated Protocol - Chromium Single Cell V(D)J Reagent Kits-Direct Target Enrichment (Document

CG000166). Amplification generates sufficient material to construct multiple libraries from the same cells, e.g. both T

cell and/or B cell enriched libraries and 5’ Gene Expression libraries. Qubit was used for library quantification before

pooling. The final library pool was sequenced on the Illumina novaseq instrument using 150-base-pair paired-end reads.

Single-Cell Data Processing

Analysis pipelines in Cell Ranger version 3.0.2 (updated version was used for the 5′ single-cell and TCR/BCR libraries

from version 2.1.0 used for the 3′ single-cell libraries) were used for the sequencing data processing. TCR/BCR data

were processed by running cellranger vdj with–reference = refdata-cellranger-vdj-GRCh38-alts-ensembl-2.0.0 to

assemble TCR/BCR chains and determine clonotypes. Transcriptome data were processed by running cellranger count

with– transcriptome = refdata-cellranger-GRCh38-1.2.0.

The output of cellranger aggr was loaded into R by using Seurat v3 (https://satijalab.org/seurat/) for cell cluster and

differentical expressed gene analysis between sample groups. The Seurat 3V was used for cluster high-quality population

cells and cell clustering (FindClusters) and tSNE visualization (RunTSNE). For the cell clustering results of Seurat, the

overall correlation between cell groups and PCA analysis were carried out, and then the bimod likelihood ratio statistical

test of Seurat V3 was used to screen the specific differential expression genes of different cell groups, which met the

requirements of pvalue < = 0.05 and more than 2 times differential expression range to screen the differential genes

between the designated cell group and other cell groups. For the differentially expressed genes screened from the

designated cell group and other cell groups, two-way hierarchical clustering was used to cluster genes and samples, and

the clustering parameters (distance metric: Pearson correlation) were displayed by thermogram; Linkage rule: average

linkage). The screening basis of cell group specific expression genes is the significant up-regulated expression genes

belonging to this cell group and not the up-regulated expression genes belonging to other cell groups. The thermogram

only shows that the top 10 genes rank in terms of the average expression amount of this cell group compared with the

difference amplitude of other cell groups.

The t-SNE coordinate information of projection_TSNE_SC.csv, or the UMAP coordinate information of

projection_UMAP_SC.csv, and the clustering category information of clusters_SC.csv can be imported into cloupe to use

the loupe cell browser for visualization.

Pseudotime Analysis

Monocle 2 (version 2.4.0) was used to estimate a pseudo temporal path of cell differentiation (35). Cells clustered in

TC1 and TC2 by Cell Ranger analysis pipelines were loaded to create a Monocle object using the new Cell DataSet

function implemented in Monocle 2. Based on all the differentially expressed genes of cell class, DDRTree method is

used to reduce the dimension and build the minimum spanning tree. Then, single cells are searched for the optimal

sequence in high and low dimension space to fit the optimal cell development or differentiation curve. If the number of

cells reaches more than 20000, 20000 representative cells are randomly selected for the following analysis.

Analysis of protein interaction network of target gene set

The protein interaction network of this species was queried and downloaded from the STRING protein interaction

network database using proteins with values/ranks - functional enrichment analysis. Due to the large number of

differential expressed genes between patients and controls, the differential expressed genes with FDR<e-5 were selected

to draw the protein interaction network map.

Integration analysis with TCR / BCR clone

According to the clone type obtained by TCR or BCR sequencing, TCR / BCR sequencing corresponds to the cell

marker sequence sequenced by 5-terminal transcripts one by one, and the cells without clone type are filtered. Based on

the binomial distribution test, the clone types satisfying p value < = 0.05 are screened for significant differences in cell

types. For the different clone types, it is shown in UMAP map.

Real time PCR

RNA was extracted from patients’ PBMC. The following primers were designed for amplification genes. GAPDH was

used as internal reference. Applied Biosystems™ SYBR™ Green was used for real time PCR analysis in 7500 Fast

Instrument (Applied Biosystems®) according to the instructions.

Realtime PCR Primers:

IFI27-forward primer: GGCCAGGATTGCTACAGTTG

IFI27-reverse primer: GAGTCCAGTTGCTCCCAGT

BST2-forward primer: GTGATGGAGTGTCGCAATGT

BST2-reverse primer: TTTGTCCTTGGGCCTTCTCT

FOS-forward primer: GCTGACTGATACACTCCAAGC

FOS-reverse primer: GGGAAGCCACAGACATCTCT

Immunohistochemistry and fluorescence microscopyPBMC smears were used for immunohistochemistry. We used 1× PBS to wash the smears three times. The tissue sectionswere then subjected to blocking using blocking buffer (5% normal donkey serum, 0.3% TritonTM X-100, and 1× PBS) for1 hour at room temperature. The sections were then incubated with primary antibody rabbit polyclonal anti-IFI27 inblocking buffer at 4°C overnight. Alexa 488-conjugated anti-rabbit secondary antibody (diluted 1:500; Molecular Probes)was incubated for 2 hours at room temperature. Nuclei were visualized by counterstaining with DAPI in secondaryantibody buffer. Finally, the tissues were washed with PBS, mounted and allowed to cure overnight at 4°C. Images werevisualized using Zeiss LSM 710 confocal microscopes.

Fig. S1 Lung CT images from ten patients with COVID-19. CT features of COVID: ground glasslike changes were identified in the lungs.

Fig. S2 Trajectory of differentiating PBMCs of 56 cell subtypes.

Fig. S3 Violin map and distributed cell subtypes of 23 newly identified marker genes.

Fig. S4 Differential expression patterns of viral mRNA translation genes in COVID-19 patients vscontrols.

A. Critical VS normal.B. Server VS normal.C. Moderate VS normalD. Cured VS normalE. SARS-COV-2 vs normalF. SARS-COV-2 vs influenza AG. SARS-COV-2 vs acute pharyngitisH. SARS-COV-2 vs cerebral infarction

Fig. S5 viral mRNA gene expression in 56 cell subtypes.

Fig. S6 Differential expression patterns of interaction alpha / beta signaling genes in patients withCOVID-19 vs other diseases.A. SARS-COV-2 vs influenza AB. B. SARS-COV-2 vs acute pharyngitisC. SARS-COV-2 vs cerebral infarction

Fig. S7 mRNA gene expression in 56 cell types of interaction alpha / beta signaling.

Fig. S8 Differential expression patterns of MAPK signaling genes in patients with COVID-19 vsother diseases.A. SARS-COV-2 vs influenza AB. SARS-COV-2 vs acute pharyngitisC. SARS-COV-2 vs cerebral infarction

Fig. S9 mRNA gene expression in 56 cell subtypes of MAPK pathways.

Fig. S10 Differential expression patterns of immunoregulatory interactions between a lymphoid anda non-lymphoid cell and cytolysis genes in patients with COVID-19 vs controls.A. Critical VS normal.B. Server VS normal.C. Moderate VS normalD. Cured VS normalE. SARS-COV-2 vs normal

F. SARS-COV-2 vs influenza AG. SARS-COV-2 vs acute pharyngitisH. SARS-COV-2 vs cerebral infarction

Fig. S11 mRNA gene expression in 56 cell subtypes of immunoregulatory interactions between alymphoid and a non-Lymphoid cell and cytolysis genes.

Fig. S12 Differential expression patterns of MHC class genes in patients with COVID-19 vs controls.A. Critical VS normal.B. Server VS normal.C. Moderate VS normalD. Cured VS normalE. SARS-COV-2 vs normalF. SARS-COV-2 vs influenza A

G. SARS-COV-2 vs acute pharyngitisH. SARS-COV-2 vs cerebral infarction

Fig. S13 MHC class gene expression in 56 cell subtypes.

Fig. S14 Enriched pathways in COVID-19 vs other diseases.A. SARS-COV-2 vs influenza AB. SARS-COV-2 vs acute pharyngitisC. SARS-COV-2 vs cerebral infarction

Fig. S15 Evolutionary conservation analysis of top TCR- and BCR-produced antibodies. A. TCRA,B, TCRB, C, IGL, D, LGK and E, IGH.

Table S1 Clinical information ten patients with COVID-19 patients and six controls.

Patient Patient 1 Patient 2 Patient 3 Patient 4 Patient 5 Patient 7 Patient 8 Patient 9 Patient 10-Cur Patient 11-Cur Patient 12-FluA Patient 13-Pha Patient14-CIS Normal-1 Normal-2 Normal-3

Disease condition Critical Server Moderate Moderate Moderate Moderate Moderate Moderate Cured Cured Influenza A Acute pharyngitis Cerebral infarction Normal control Normal control Normal control

Interval between

symptom onset and

arrival at

Wuhan(days)

He has never been

to wuhan (living in

jiangxi, driving to

mianyang from

jiangxi).

He has been

working in wuhan

for a long time. He

drove back to

mianyang on

January 23

She has never been

to wuhan (she has

lived in jiangxi for

a long time and

drove to mianyang

from jiangxi).

He Never been to

wuhan (1.18-1.21

meeting in

changsha)

Long-term resident

in wuhan (student

of a university)

She went to

chengdu airport on

January 20 to pick

up her husband.

The plane her lover

took was from

haikou to Chengdu,

and the previous

flight of the plane

was from wuhan to

Haikou

NAShe has never been

to wuhan

She took an

internship in a

hospital in Wuhan

in July 2019 and

returned to Zigong

on January 20, 2020

The patient began

to work in

Huangmei county,

Hubei province on

November 22,

2019.01.16 and

drove away to

return to Zigong

NA NA NA NA NA NA

Relationship with

patients with novel

coronavirus

NA NA NA NA NA NA NAThe patient's

mother-in-lawNA NA NA NA NA NA NA NA

The time from

symptom onset to

get in touch with

the patient

NA NA NA NA NA NA NA5 (contact

exposure)NA NA NA NA NA NA NA NA

Generations of

virusesNA NA NA NA NA NA NA

Second generation,

infected by

son-in-law

NA NA NA NA NA NA NA NA

Days from onset to

sampling (days)14 8 10 12 7 4 10 10 21 23 12 NA NA NA NA NA

Age(years) 34 43 33 26 25 59 46 62 20 40 24 59 71 57 61 28

Sex Male Male Female Male Male Female Female Female Female Male Female Male Female Female Male Male

Smoking / drinking Occasional drinkingNA NA NA NA NA NA NA NOHe has a habit of

smoking, smokingNA NA NA NA NA NA

for 20 + years,

about 10 cigarettes

a day. He denies

quitting smoking.

He has a habit of

drinking, drinking

for 20 years, about

350 grams a day.

Occupation Engineer Staff Staff Engineer Student Retired NA Retired Nurse NA NA NA NA NA NA NA

Underlying diseasesAppendicitis

operationNA NA NA No NA NA NA NA

Type 2 diabetes, 2

+ years historyNA NA NA NA NA NA

Interval between

admission to

hospital and

symptom

onset(days)

NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA

CT image features

of lung (provide

image)

Micro ground glass

shadow

Micro ground glass

shadow

Left lower lung

patch, consistent

with viral

pneumonia

Micro ground glass

shadow

Micro ground glass

shadow

Ground glass

shadow in the outer

zone of right lower

lobe of lung

Micro ground glass

shadow

A ground glass

dense nodule

shadow can be seen

in the posterior

segment of the

upper lobe tip of the

left lung

A little ground

glass exudation

shadow under the

pleura in the lower

left lung

Left and right lungs

scattered with

multiple spots and

flakes

Micro ground glass

shadowNA NA NA NA NA

Presenting

symptoms and

signs

NA NA NA NA NA NA NA NA

Cough,

expectoration, small

amount, cough

white sputum,

fearless of cold,

fever, chest

tightness, chest

pain, dyspnea,

NA NA NA NA NA NA NA

nausea, vomiting,

unconsciousness,

out of hospital

medication

(unknown), no

significant relief of

symptoms

Fever + + + + NA NA NA NA + NA NA NA NA NA NA NA

Cough + + + + + + + - + +（dry） + NA NA NA NA NA

Generalised

weakness+ - - - - - + (干) + (干) - - + NA NA NA NA NA

Nasal congestion - - - - - + + - - - - NA NA NA NA NA

Rhinorrhoea - - - - - - - - - - - NA NA NA NA NA

Sneezing - - - - - - - - - - - NA NA NA NA NA

Sore throat - - - - - - - - - - - NA NA NA NA NA

chest pain - - + - - - - - - - - NA NA NA NA NA

Diarrhoea - - - - - - - - - - - NA NA NA NA NA

Body temperature

(°C)40.2 37.7 38.5 37.4 37.9 37℃ 37.5 37 37 37 36.7 NA NA NA NA NA

Hematocrit (normal

range 0.40-0.50)0.398 0.46 0.31 0.43 0.38 51.30 37.10 35.50 36.80 39.90 44.60 46.90 43.80 45.70 43.10 44.20

Mean corpuscular

volume (fl) (normal

range 82-100)

94.5 92.00 72.00 92.00 90.00 87.80 93.40 89.50 70.20 84.40 88.60 91.70 87.60 90.30 94.80 87.70

Mean corpuscular

hemoglobin (pg)

(normal range

27-34)

30.9 31.00 23.30 31.80 30.40 30.00 31.90 30.50 21.90 26.80 30.40 29.60 28.70 29.30 30.00 27.60

RBC distribution

width (%); (normal- 12.60 17.00 343.00 10.90 39.50 NA NA NA NA 40.00 43.60 37.80 39.50 45.10 40.10

range 10-16)

Platelet count (×

10⁹ cells /

L);(normal range

100–300)

299 142.00 236.00 132.00 227.00 274.00 NA NA 173.00 118.00 228.00 214.00 NA 156.00 111.00 248.00

Lymphocyte (%);

(normal range

20-50)

7.3 30.40 15.70 23.10 18.90 34.70 NA 27.40 26.00 24.00 22.60 13.40 17.50 33.00 31.70 39.30

Monocyte (%);

(normal range 3-10)3.1 14.50 9.20 11.40 9.10 5.50 8.20 6.80 12.30 11.20 7.00 6.40 3.80 4.20 7.60 8.70

Neutrophils(%);

(normal

range40-75)

89.5 52.90 74.00 64.10 70.20 58.90 68.10 65.00 61.10 64.40 65.80 79.30 77.90 61.10 59.10 49.70

Eosinophils (%);

(normal range

0.4-7)

0 1.30 0.70 0.90 1.30 0.60 0.10 0.60 0.40 0.00 4.30 0.60 0.50 1.40 1.10 1.90

Basophils (%);

(normal range 0-2)0.1 0.90 0.40 0.50 0.50 0.30 0.20 0.20 0.20 0.40 0.30 0.30 0.30 0.30 0.50 0.40

Lymphocyte count

(× 10⁹ cells / L);

(normal range

1.1-3.2)

0.75 1.00 1.52 0.90 1.46 2.20 1.03 1.40 2.32 1.16 1.58 1.85 1.37 2.68 1.37 2.12

Monocytes (× 10⁹

cells / L); (normal

range 0.1 - 0.6)

0.32 0.48 0.89 0.44 0.70 0.35 0.36 0.35 1.10 0.54 0.49 0.88 0.30 0.34 0.33 0.47

Neutrophils (× 10⁹

cells / L); (normal

range 1.8 - 6.3)

9.25 1.75 7.18 2.50 5.41 3.73 2.98 3.32 5.46 3.12 4.69 10.94 6.12 4.97 2.55 2.68

Eosinophils (× 10⁹

cells / L); (normal

range 0.02-0.52)

0 NA 0.03 0.04 0.10 0.04 0.00 0.03 0.04 0.00 0.30 0.08 0.04 0.11 0.05 0.10

Basophils (× 10⁹

cells / L); (normal

range 0 - 0.2)

0.01 NA 0.04 0.02 0.04 0.02 0.01 0.01 0.02 0.02 0.02 0.04 0.02 0.02 0.02 0.02

Leukocytes (× 10⁹

cells / L); (normal

range 3.5-9.5)

10.34 3.30 9.70 3.90 7.70 6.34 4.38 5.11 8.93 4.84 6.97 13.80 7.85 8.13 4.32 5.40

Erythrocytes (× 10⁹

cells / L); (normal

range 4.3-5.8)

4.21 5.06 4.30 4.66 4.24 5.84 3.98 3.97 5.24 4.73 5.03 5.11 5.00 5.06 4.54 5.04

Table S2 List of known marker genes, new marker genes and highly expressed genes of 56 cell subtypes identified by integrated analysis of allthe sequenced samples.

Cell (Sub)Type Other information Known marker New marker Highly expressed genes

CD4+ T cell CD4+ T helper LTB, IL7R - LDHB, LEF1, JUNB, SARAF, TCF7, NOSIP, MAL, CDR7

Naive CD8+ T cell LEF1, LDHB - EEF1B2, EEF1A1, NOSIP, ARAF,TCF7,TPT1, CCR7, C12orf57

CD4+ cytotoxic T cell CCL5, CST7 - GNLY, NKG7, GZMB, PRF1, CST7, GZMH, FGFBP2, CCL5, CTSW, FCGR3A

CD4+ T cell CD4+ T helper LTB, IL7R - JUNB, TNFAIP3, CD69, JUN, AQP3, KLF6,VIM,ZFP36L2

CD8+ T cell Naive CD8+ T cell LEF1, CD8A, CD8B - LINC02446, EEF1B2, NELL2, EEF1A1, LDHB, NOSIP, SARAF

B cell memory B cell CD19 MS4A1 CD74, HLA-DRA, CD79A, TCL1A, HLA-DRB1, HLA-DPA1, HLA-DPB1, CD37, HLA-DQB1

CD1C+_B dendritic cell BSET1,CD1D,CD163,CES1,CFS3R, VCAN CST3 SA1009, LYZ, S100A8, FCN1, S100A12, FOS, IFI27, CTSS

CD4+ cytotoxic T cell CST7,CCL4, CD7 - GNLY, NKG7, GZMB, PRF1, SPON2, CTSW, GZMA, CLIC3, FCGR3A

CD8 cytoxict cells CD3D, CD8A,CD8B - GZMH, NKG7, CCL5, CST7, GZMA, IL32, FGFBP2, GZMM,

CD4+ T helper CD3D,CD3E,IL7R - IL32, IL7R, CD3G, LDHB, SARAF, AL138963.3, HBB, C12orf57

CD8+ T cell CD8 cytoxict cells CD8A,CD8B,GZMK - CCL5, IL32, GZMA, DUSP2,LYAR, CMC1, CD2

CD8 cytoxict cells Similar to cluster 9 CD3D, CD8A,CD8B - GNLY, GZMH, NKG7, CCL5, CCST7, GZMB, FGFBP2, GZMA, IL32,

CD1C+_B dendritic cell CD14,CFS3R, VCAN CST3 S100A8, S100A12, S100A6, CST7, LYZ, FOS, IFITM3,AIF1, FTH1, TYROBP

Effector CD8+ memory T (Tem)

cellTAGLN2 - PPBP, TUBB1, CLU, CAVIN2, PF4, MYL9, GNG11, SPARC, NRGN, HIST1H2AC

Memory B cell CD27 - LTB, IL32, AQP3, CD52, GSTK1, CNN2, LDHB, CORO1B, CD3D

B cell Activated B cell CD19 MS4A1 CD74, HLA-DRA, CD79A, IGKV3-20, HLA-DRB1, HLA-DPA1, HLA-DPB1, HLA-DQB1, HLA-DQB1

CD4+ T helper LTB,LDHB - PPBP, CLU, PF4, NRGN, MYL9, SPARC, PF4V1, GNG11, CAVIN2

CD4+ T cell CD4+ T helper LTB, IL7R TRBV5-1 EEF1A1, IL7R, CD3E, SARAF, MAL, LEF1, TCF7

CD1C+_B dendritic cellADAM15,BST1,CD1D,CD163,CLEC10A,C

FS3R, VCANCST3 CST3, LYZ, HLA-DRA, HLA-DRB1, IFI27, S100A9, FCN1, HLA-DRB5, AIF1, CD74

Activated CD4+ T cell or

MonocyteCD69, KLRG1;KLRB1 - GZMK, DUSP1, JUN, AC245014.3, TNFAIP3, NCR3, FOS

CD4+ cytotoxic T cell CCL5, CST7 TRDV2 TRGV9, NKG7, GNLY, TRDC, GZMH, KLRC1

CD8+ T cell Naive CD8+ T cell LEF1, CD8A, CD8B - LINC02446,S100B, NELL2, EEF1B2, CCR7, EEF1A1, LDHB

Megakaryocyte progenitor cell PPBP, PF4 - HISTI1H2AC, TUBB1, CAVIN2, RGS18, TSC22D1, GP9, HIST1H3H, TMEM40, GNG11

CD4+ T helper IL7R - MT-CO1, MT-CO2, MT-CYB, MT-ND3, MT-,ATP6, MT-ND4L, MT-CO3, MT-ATP8, MALAT1, MTRNR2L12

CD8 cytoxict cells Similar to cluster 35 - TRBV20-1 LDHB, SARAF, LTB, EEF1A1, LEF1, TCF7, EEF1B2, NOSIP, MAL

CD4+ cytotoxic T cell CCL5, CST7 - NKG7, PRF1, SPON2, GZMB, CLIC3, CTSW, MYOM2, GZMA, KRB1

CD4+ T helper LTB, IL7R - TRBV20-1,AQP3, CD3E, LDHB, GSTK1, PBXIP1, JUNB, IL32

CD4+ T helper LTB, IL7R TRBV7-9 EEF1A1, LDHB, SARAF, CD3E, LEF1, TPT1, MAL

CD4+ T helper LTB,LDHBTRBV28,TRBV2

6EEF1A1, TPT1, SARAF, EEF1B2, MAL, IL7R, LEF1

CD1C+_B dendritic cell CFS3R, VCAN KLF6 NEAT1, SAT1, MT-CO1, KLF6, CSF3R, NFKBIZ, ZEB2, MT-CO2, VCAN, NAMPT

Megakaryocyte progenitor cell PPBP, PF4 - HIST1H2AC, CAVIN2, GNG11, TUBB1, RGS18,CLU, GP9, NRGN

CD8+ T cell CD8 cytoxict cells CD3D, CD8A,CD8B - TRBV-9, GZMH, CCL5, NKG7, CST7, GZMA, B2M, IL32

Plasmacytoid dendritic cell STMN1 - HMGB2, TUBA1B, TUBB, HIST1H4C, TYMS, HMGN2, H2AFZ, GAPDH, DUT

AXL+SIGLEC6+ dendritic cell CTSW - GNLY, GZMK, CTSW, XCL1, KLRD1, CMC1, CD7, XCL2, NKG7, HOPX

CD8 cytoxict cells Similar to cluster 9 CD8A, CD8B, CCL5, CST7 TRBV20-1 GZMK, IL32, CST7, NKG7, KLRG1, B2M, CD2

Plasmacytoid dendritic cell SEC11C, MZB1 IGLC2, IGHG1 TRBV5, TRGC2, TRAV14DV4, IL32, NKG7, B2M, GZMH, GZMA,CCL5, CST7

CD4+ cytotoxic T cell CCL5, CST7,LYAR TRDV2 GZMK, TRGV9, KLRB1, GZMA, NKG7, LYAR

CD1C-CD141- dendritic cell AIF1,LST1 - CST3, SERPINA1, PSAP, FCER1G, IFITM3, FTL,COTL1, CFD

CD1C+_B dendritic cell

S100A8,

S100A9,S100A12,MNDA,I

FITM2

S100A8, S100A9,S100A12,MNDA,IFITM2 LCN2 LCN2, CAMP, LTF, CPNE3, MNDA, CYSTM1, LAMTOR4

CD4+ cytotoxic T cell CCL5, CST7 - GNLY, NKG7, GZMB,PRE1, GZMH, FGFBP2, GZMA, KLRD1

CD8+ T cell Naive CD8+ T cell CD8A,CD8B,NELL2,LEF1 - TRBV7-9, LINC02446, CCR7, EEF1B2, SARAF, CD3E

CD1C+_A dendritic cell CD52, CX3CR1 - AC006369.1, TRBV28, GZMK, CCL5, CD8B, GPN1, DUSP2, CST7, LYAR, IL32

CD8+ T cellEffector CD8+ memory T

(Tem) cellSYNE1 - RNF213, PTPRC, SYNE2, UTRN, MACF1, LNPEP, MBP, PRF1, GNPTAB

Megakaryocyte progenitor cell PPBP, PF4 - LINC02446, CD8B, TUBB1, CAVIN2, GNG11, CLU, MPIG6B, SPARC

CD141+CLEC9A+ dendritic cell RGS10 RGS10NEXN,HIST1H2

BHHIST1H4H, RGS18, HIST1H3H1, NT5C3A, CA2, PF4, TSC22D1,H3F3A

CD8+ T cell CD8A,CD8B - TRBV20-1, LINC02446, EEF1A1, NELL2, LEF1, EEF1B2, TCF7, LDHB

CD4+ T cell CD4+ T helper - TRBV5-1 TRAV14DV4, EEF1A1, LTB, LEF1, LDHB, MAL, IL7R, CCR7, SARAF

Naive CD8+ T cell LEF1, LDHB TRBV19 EEF1A1, NACA, TPT1, SARAF, FAU, LTB

B cell Activated B cell CD19 MS4A1 LINC00926, FAM19C, MT-CO2, RALGPS2, MT-ND3, MT-CO1, AFF3, BACH2, ADK

CD4+ T cell LTB,LDHB TRBV7-6 TRBV7-9, TRBV7-4, EEF1A1, TRBV7-2, SARAF, EEF1B2, TRBV7-7

CD4+ T helper - TRBV26 TRBV28, CD8B, LINC02446, CD8A, EEF1A1, NELL2, LEF1, EEF1B2, NUCB2, CARS

CD8+ T cell CD8A,CD8B - TRBV5-1, LINC02446, EEF1A1, NELL2, LEF1, EEF1B2, CCR7, LDHB

Plasmacytoid dendritic cellLILRA4, ITM2C, IRF7, IRF8,LILRA4,

PLD4 -CD74, TXN, JCHAIN, CCDC50, ALOX5AP

AXL+SIGLEC6+ dendritic cell SOX4SPINK2,AC0840

33.3,MRPS27CDK6, C8orf88, CHID1, PRKG2, UBR5-AS1, NET1

CD4+ T cell LTB

AP00238.7,

EPHA1-AS1,BET

1L,SESN1,

P2RY10,

KIAA0391

EPHA1-AS1, RRAGA, NDUFA8, NUBP2, TCERG1

CD4+ T cell Similar to cluster 55 LTB AP00238.7 NMD3, DEGS1, COMMD2, ZNF581, CAPN7, CIAPIN1, HADH, RABGGTB, ZFAN2B, COQ10B

Table S3 Compared with the normal controls, significant enriched pathways of each cell subtypes in the critical condition (patient 1).

ClusterClu

ster#term ID term description direction

false

discovery

rate

matching proteins in your input (labels)

CD1C+_B

dendritic cell8 CL:18630 MHC class II protein complex top of list 0.0022CD74,HLA-DMA,HLA-DPA1,HLA-DPB1,HLA-DQA1,HLA-DQB1,HLA-DRA,HLA-DRB1

CD1C-CD141-

dendritic cell22 CL:14978 Peptide chain elongation bottom of list 2.56E-06

RPL11,RPL12,RPL13A,RPL18,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL34,RPL35,RPL35A,RPL36,RPL37,RPL37A,RPL38

,RPL39,RPL7,RPL9,RPLP0,RPLP1,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS29,RPS3A,RPS7,RPS8

CD1C-CD141-

dendritic cell22 CL:14967

GTP hydrolysis and joining of the 60S ribosomal

subunit, and Protein exportbottom of list 2.56E-06

PABPC1,RPL11,RPL12,RPL13A,RPL18,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL34,RPL35,RPL35A,RPL36,RPL37,RPL3

7A,RPL38,RPL39,RPL7,RPL9,RPLP0,RPLP1,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS29,RPS3A,RPS7,RPS8

CD1C-CD141-


RPL11,RPL12,RPL13A,RPL18,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL35,RPL35A,RPL36,RPL37,RPL37A,RPL38,RPL39

,RPL7,RPL9,RPLP0,RPLP1,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS29,RPS3A,RPS7,RPS8

CD1C-CD141-


RPL11,RPL12,RPL13A,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL35,RPL35A,RPL36,RPL37,RPL37A,RPL38,RPL39,RPL7,

RPL9,RPLP0,RPLP1,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS29,RPS3A,RPS7,RPS8

CD1C-CD141-


RPL11,RPL12,RPL13A,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL35,RPL35A,RPL36,RPL37,RPL37A,RPL38,RPL39,RPL7,

RPL9,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS3A,RPS7,RPS8

CD1C-CD141-

dendritic cell22 CL:14985 Viral mRNA Translation bottom of list 8.97E-05

RPL11,RPL12,RPL13A,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL35,RPL35A,RPL36,RPL37A,RPL38,RPL39,RPL7,RPL9,RPS13,R

PS19,RPS21,RPS26,RPS28,RPS3A,RPS7,RPS8

CD1C-CD141-


mixed, incl. lipoteichoic acid binding, and

neutrophil aggregationbottom of list 0.0036CD14,S100A8,S100A9

CD4+ T helper 23 CL:4212

Immunoregulatory interactions between a

Lymphoid and a non-Lymphoid cell, and

Cytolysis

both ends 5.60E-06B2M,GNLY,GZMK,HLA-B,HLA-C,HLA-E




Cytolysis

both ends 1.20E-05B2M,CD2,GNLY,GZMK,HLA-B,HLA-C,HLA-E

CD4+ T helper 23 CL:4218MHC class I protein complex, and inhibitory MHC

class I receptor activitytop of list 4.40E-05B2M,HLA-B,HLA-C,HLA-E

CD4+ T helper 23 CL:4209 mixed, incl. Immunoregulatory interactions both ends 4.40E-05B2M,CD2,CD27,CD7,GNLY,GZMK,HLA-B,HLA-C,HLA-E

between a Lymphoid and a non-Lymphoid cell,

and T cell costimulation

CD4+ T helper 23 CL:4220MHC_I C-terminus, and MHC class I protein

complex bindingtop of list 0.00055HLA-B,HLA-C,HLA-E

CD8+ T cell 24 CL:4212



Cytolysis

both ends 5.60E-06B2M,GNLY,GZMK,HLA-B,HLA-C,HLA-E




Cytolysis

both ends 1.20E-05B2M,CD2,GNLY,GZMK,HLA-B,HLA-C,HLA-E

CD8+ T cell 24 CL:4218MHC class I protein complex, and inhibitory MHC

class I receptor activitytop of list 4.40E-05B2M,HLA-B,HLA-C,HLA-E


mixed, incl. Immunoregulatory interactions



both ends 4.40E-05B2M,CD2,CD27,CD7,GNLY,GZMK,HLA-B,HLA-C,HLA-E

CD8+ T cell 24 CL:4220MHC_I C-terminus, and MHC class I protein

complex bindingtop of list 0.00055HLA-B,HLA-C,HLA-E

CD4+ cytotoxic

T cell25 CL:14978 Peptide chain elongation top of list 0.00073

EEF1A1,RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPLP1,RPS12,RPS14,RPS15,RPS16,RPS18,RPS27,RPS4X,

RPS6

CD4+ cytotoxic

T cell25 CL:14967


subunit, and Protein exporttop of list 0.00073

EEF1A1,PABPC1,RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPLP1,RPS12,RPS14,RPS15,RPS16,RPS18,RPS2

7,RPS4X,RPS6

CD4+ cytotoxic

T cell25 CL:14966


subunit, and Protein exporttop of list 0.00073

EEF1A1,PABPC1,RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPLP1,RPS12,RPS14,RPS15,RPS16,RPS18,RPS2

7,RPS4X,RPS6,TPT1

CD4+ cytotoxic

T cell25 CL:4615 neutrophil aggregation, and Aquaporin 9 bottom of list 0.0018S100A12,S100A8,S100A9

CD4+ cytotoxic

T cell25 CL:14985 Viral mRNA Translation top of list 0.0018RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPS12,RPS14,RPS15,RPS16,RPS18,RPS4X,RPS6

CD4+ cytotoxic

T cell25 CL:14982 Peptide chain elongation top of list 0.0018RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPLP1,RPS12,RPS14,RPS15,RPS16,RPS18,RPS27,RPS4X,RPS6

CD4+ cytotoxic

T cell25 CL:4594


neutrophil aggregationbottom of list 0.002S100A12,S100A8,S100A9,TYROBP

CD4+ cytotoxic

T cell25 CL:4560

immunoglobulin binding, and Immunoregulatory

interactions between a Lymphoid and a

non-Lymphoid cell

bottom of list 0.0022FCER1G,S100A12,S100A8,S100A9,TYROBP

CD4+ cytotoxic

T cell25 CL:10246

specific granule lumen, and azurophil granule

lumenbottom of list 0.0077CAMP,CST3,GCA,LCN2,LTF,LYZ,MNDA,OLFM4,PGLYRP1,RETN




Cytolysis

top of list 0.0003B2M,GNLY,GZMB,HLA-B,HLA-C

CD1C-CD141-


RPL12,RPL13,RPL13A,RPL22,RPL27A,RPL28,RPL29,RPL31,RPL32,RPL34,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL39,RPLP2,

RPS11,RPS12,RPS15,RPS15A,RPS19,RPS2,RPS20,RPS23,RPS27,RPS3A,RPS8

CD1C-CD141-

dendritic cell33 CL:18630 MHC class II protein complex top of list 2.62E-05CD74,HLA-DMA,HLA-DMB,HLA-DPA1,HLA-DPB1,HLA-DQA1,HLA-DQB1,HLA-DRA,HLA-DRB1

CD1C-CD141-


RPL12,RPL13,RPL13A,RPL22,RPL27A,RPL28,RPL29,RPL31,RPL32,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL39,RPLP2,RPS11,

RPS12,RPS15,RPS15A,RPS19,RPS2,RPS20,RPS23,RPS27,RPS3A,RPS8

CD1C-CD141-


mixed, incl. MAPK targets/ Nuclear events

mediated by MAP kinases, and bZIP Maf

transcription factor

bottom of list 2.76E-05DUSP1,FOS,JUN,JUND

CD1C-CD141-


RPL12,RPL13,RPL13A,RPL22,RPL28,RPL29,RPL31,RPL32,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL39,RPLP2,RPS11,RPS12,R

PS15,RPS15A,RPS19,RPS2,RPS20,RPS23,RPS27,RPS3A,RPS8

CD1C-CD141-



subunit, and Protein exportbottom of list 3.34E-05

PABPC1,RPL12,RPL13,RPL13A,RPL22,RPL27A,RPL28,RPL29,RPL31,RPL32,RPL34,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL3

9,RPLP2,RPS11,RPS12,RPS15,RPS15A,RPS19,RPS2,RPS20,RPS23,RPS27,RPS3A,RPS8

CD1C-CD141-


MHC class II protein complex, and dynactin

complextop of list 7.23E-05CD74,HLA-DMA,HLA-DMB,HLA-DPA1,HLA-DPB1,HLA-DQA1,HLA-DQA2,HLA-DQB1,HLA-DRA,HLA-DRB1

CD1C-CD141-


RPL12,RPL13,RPL13A,RPL22,RPL29,RPL32,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL39,RPLP2,RPS11,RPS12,RPS15,RPS15A

,RPS19,RPS2,RPS23,RPS3A,RPS8

CD1C-CD141-

dendritic cell33 CL:14985 Viral mRNA Translation bottom of list 0.00013

RPL12,RPL13,RPL13A,RPL22,RPL29,RPL35,RPL36,RPL37A,RPL38,RPL39,RPS11,RPS12,RPS15,RPS15A,RPS19,RPS2,RPS23,

RPS3A,RPS8

CD1C-CD141-


peptide antigen assembly with MHC class II

protein complextop of list 0.00021CD74,HLA-DMA,HLA-DMB,HLA-DRA,HLA-DRB1

CD1C-CD141-


AP-1 transcription factor, and Transcription factor

Junbottom of list 0.0011FOS,JUN,JUND

CD8+ T cell 34 CL:22327 Oxidative phosphorylation top of list 0.0036ATP6V1G1,COX6C,MT-ND3,MT-ND4,MT-ND4L


mixed, incl. Immunoregulatory interactions



top of list 0.0036B2M,CD7,HLA-B,HLA-C

CD8+ T cell 34 CL:22328 respirasome top of list 0.0049COX6C,MT-ND3,MT-ND4,MT-ND4L

CD8+ T cell 34 CL:4218MHC class I protein complex, and inhibitory MHC

class I receptor activitytop of list 0.0055B2M,HLA-B,HLA-C

Table S4 Compared with the normal controls, significant enriched pathways of each cell subtypes in the severe condition (patient 2).

typeCell

Cluster#term ID term description direction

false

discovery

rate


Naive CD4+ T cell 1CL:14978 Peptide chain elongation top of list 0.003RPL3,RPL4,RPS2,RPS26,RPS4X

Naive CD4+ T cell 1CL:14985 Viral mRNA Translation top of list 0.0035RPL3,RPS2,RPS26,RPS4X

Naive CD4+ T cell 1CL:22328 respirasome top of list 0.0035MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 2CL:22328 respirasome top of list 5.46E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 2CL:22327 Oxidative phosphorylation top of list 6.51E-06ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 2CL:4662Interferon alpha/beta signaling, and Interferon-induced protein

44 family

bottom of

list0.00013BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1

CD4+ T cell 2CL:14985 Viral mRNA Translation top of list 0.00013RPL13A,RPL21,RPL3,RPS2,RPS26,RPS27A,RPS4X

CD4+ T cell 2CL:4661Interferon alpha/beta signaling, and Interferon gamma

signaling

bottom of

list0.00013

BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM2

2,XAF1

CD4+ T cell 2CL:4665 Interferon alpha/beta signalingbottom of

list0.00013BST2,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

CD4+ T cell 2CL:14982 Peptide chain elongation top of list 0.00013RPL13A,RPL21,RPL3,RPS2,RPS20,RPS26,RPS27A,RPS4X

CD4+ T cell 2CL:22502 Leber hereditary optic neuropathy top of list 0.00047MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD4+ T cell 2CL:22332 mitochondrial respiratory chain complex I top of list 0.0013MT-ND2,MT-ND3,MT-ND4L,MT-ND5

CD4+ T cell 2CL:4668 type I interferon signaling pathwaybottom of

list0.0013BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1


list0.0013IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1

CD4+ T cell 2CL:46732'-5'-oligoadenylate synthase, and type I interferon signaling

pathway

bottom of

list0.0049IFI6,IFIT3,IRF7,MX1,MX2,OAS1,XAF1

CD4+ T cell 2CL:22408 Leber hereditary optic neuropathy top of list 0.0055MT-ND2,MT-ND4L,MT-ND5

Effector CD8+ memory T

(Tem) cell3CL:22328 respirasome top of list 3.70E-07MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3

Effector CD8+ memory T 3CL:22327 Oxidative phosphorylation top of list 3.70E-07ATP5J2,ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,M

(Tem) cell T-ND5,NDUFA3


(Tem) cell3CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 1.97E-06MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4


(Tem) cell3CL:22502 Leber hereditary optic neuropathy top of list 2.77E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4


(Tem) cell3CL:4665 Interferon alpha/beta signaling

bottom of

list0.0001

BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,SAMD9L,

XAF1


(Tem) cell3CL:22332 mitochondrial respiratory chain complex I top of list 0.00074MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3


(Tem) cell3CL:22408 Leber hereditary optic neuropathy top of list 0.001MT-ND1,MT-ND2,MT-ND4L,MT-ND5


(Tem) cell3CL:4668 type I interferon signaling pathway

bottom of

list0.001BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1



bottom of

list0.0015IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1


(Tem) cell4CL:22328 respirasome top of list 3.30E-07MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5


(Tem) cell4CL:22327 Oxidative phosphorylation top of list 3.30E-07ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5



bottom of

list3.35E-05

BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,SAMD9L,XA

F1


(Tem) cell4CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 3.35E-05MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4


(Tem) cell4CL:22502 Leber hereditary optic neuropathy top of list 4.49E-05MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4



bottom of

list0.00034BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1



bottom of

list0.00069IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1

Effector CD8+ memory T 4CL:22332 mitochondrial respiratory chain complex I top of list 0.0019MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5

(Tem) cell


(Tem) cell4CL:4662

Interferon alpha/beta signaling, and Interferon-induced protein

44 family

bottom of

list0.0022

BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,PLSCR1,RS

AD2,SAMD9L,XAF1


(Tem) cell4CL:4673

2'-5'-oligoadenylate synthase, and type I interferon signaling

pathway

bottom of

list0.0035IFI35,IFI6,IFIT1,IFIT3,IRF7,MX1,MX2,OAS1,OASL,RSAD2,XAF1


(Tem) cell4CL:4661

Interferon alpha/beta signaling, and Interferon gamma

signaling

bottom of

list0.0035

BST2,EPSTI1,GBP1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OASL

,PLSCR1,RSAD2,SAMD9L,TRIM22,XAF1


(Tem) cell4CL:4659


signaling

bottom of

list0.0057


,PLSCR1,RSAD2,SAMD9L,SP110,TRIM22,XAF1


(Tem) cell4CL:22408 Leber hereditary optic neuropathy top of list 0.0071MT-ND1,MT-ND2,MT-ND4L,MT-ND5



bottom of

list1.33E-05BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1


(Tem) cell5CL:22327 Oxidative phosphorylation top of list 9.75E-05MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5


(Tem) cell5CL:22328 respirasome top of list 0.00012MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5



bottom of

list0.00019BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1



bottom of

list0.00028IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1


(Tem) cell5CL:4662


44 family

bottom of

list0.00096

BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,PLSCR1,RS

AD2,XAF1


(Tem) cell5CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0017MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4


(Tem) cell5CL:4673


pathway

bottom of

list0.0017IFI35,IFI6,IFIT1,IFIT3,IRF7,MX1,MX2,OAS1,OASL,RSAD2,XAF1


(Tem) cell5CL:4659


signaling

bottom of

list0.0017


,PLSCR1,RSAD2,SP110,TRIM22,XAF1

Effector CD8+ memory T 5CL:4661 Interferon alpha/beta signaling, and Interferon gamma bottom of 0.0017BST2,EPSTI1,GBP1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OASL

(Tem) cell signaling list ,PLSCR1,RSAD2,TRIM22,XAF1


(Tem) cell5CL:22502 Leber hereditary optic neuropathy top of list 0.0033MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD8+ T cell 6CL:14985 Viral mRNA Translation top of list 0.0046RPS2,RPS26,RPS4X

CD4+ T cell 7CL:22328 respirasome top of list 2.20E-07MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 7CL:22327 Oxidative phosphorylation top of list 2.20E-07ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5


list0.00012BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1


signaling

bottom of

list0.00012

BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,TRIM22,X

AF1


CD4+ T cell 7CL:14985 Viral mRNA Translation top of list 0.00012RPL13,RPL13A,RPL21,RPL3,RPS19,RPS2,RPS26,RPS27A,RPS4X


44 family

bottom of

list0.00016BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

CD4+ T cell 7CL:22332 mitochondrial respiratory chain complex I top of list 0.00037MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5


list0.0035IFI27,IFI35,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1


list0.0035BST2,IFI27,IFI35,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1

CD4+ T cell 7CL:22408 Leber hereditary optic neuropathy top of list 0.004MT-ND1,MT-ND2,MT-ND4L,MT-ND5


(Tem) cell8CL:22328 respirasome top of list 7.25E-06MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10


(Tem) cell8CL:22327 Oxidative phosphorylation top of list 7.25E-06MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10



bottom of

list2.90E-05BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,SAMD9L,XAF1


(Tem) cell8CL:4662


44 family

bottom of

list3.19E-05

BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,PLSCR1,SAMD9L,XA

F1


(Tem) cell8CL:22502 Leber hereditary optic neuropathy top of list 0.00013MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4


(Tem) cell8CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.00029MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4,UQCR10



bottom of

list0.00048BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,XAF1



bottom of

list0.0012IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,XAF1


(Tem) cell8CL:22408 Leber hereditary optic neuropathy top of list 0.0082MT-ND2,MT-ND4L,MT-ND5


(Tem) cell8CL:4673


pathway

bottom of

list0.0082IFI35,IFI6,IFIT1,IFIT3,IRF7,MX1,OAS1,XAF1


(Tem) cell8CL:4661


signaling

bottom of

list0.0082

BST2,EPSTI1,GBP1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,

SAMD9L,TRIM22,XAF1


(Tem) cell8CL:22332 mitochondrial respiratory chain complex I top of list 0.0082MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3

CD1C+_B dendritic cell 9CL:14967GTP hydrolysis and joining of the 60S ribosomal subunit, and

Protein exporttop of list 7.60E-07

EEF1A1,EEF2,EIF1,EIF3L,EIF4B,PABPC1,RPL21,RPL26,RPL28,RPL3,RPL4,RPL5,RPL6,RPLP0,RPS2,RPS26,RPS27A,RP

S3A,RPS4X,RPS6



EEF1A1,EEF1B2,EEF2,EIF1,EIF3L,EIF4B,PABPC1,RPL21,RPL26,RPL28,RPL3,RPL4,RPL5,RPL6,RPLP0,RPS2,RPS26,RP

S27A,RPS3A,RPS4X,RPS6,TPT1

CD1C+_B dendritic cell 9CL:14978 Peptide chain elongation top of list 8.40E-06EEF1A1,EEF2,RPL21,RPL26,RPL28,RPL3,RPL4,RPL5,RPL6,RPLP0,RPS2,RPS26,RPS27A,RPS3A,RPS4X,RPS6

CD1C+_B dendritic cell 9CL:14982 Peptide chain elongation top of list 3.80E-05EEF2,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS2,RPS26,RPS27A,RPS3A,RPS4X,RPS6

CD1C+_B dendritic cell 9CL:14983 Peptide chain elongation top of list 7.75E-05EEF2,RPL21,RPL26,RPL3,RPL6,RPS2,RPS26,RPS27A,RPS3A,RPS4X,RPS6

CD1C+_B dendritic cell 9CL:14985 Viral mRNA Translation top of list 0.00023RPL21,RPL26,RPL3,RPL6,RPS2,RPS26,RPS27A,RPS3A,RPS4X,RPS6

CD1C+_B dendritic cell 9CL:22328 respirasome top of list 0.00025MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD1C+_B dendritic cell 9CL:4668 type I interferon signaling pathwaybottom of

list0.00077BST2,IFI27,IFI35,IFI6,IFIT2,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1


list0.00077IFI27,IFI35,IFI6,IFIT2,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1


44 family

bottom of

list0.0001

BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,SAMD9

L,XAF1

CD8+ T cell 10CL:4665 Interferon alpha/beta signaling bottom of 0.0001BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,SAMD9L,XAF1

list

CD8+ T cell 10CL:22328 respirasome top of list 0.00039MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3


list0.0007IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1

CD8+ T cell 10CL:22327 Oxidative phosphorylation top of list 0.0007ATP6V0E1,MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3


list0.0007BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1

CD8+ T cell 10CL:14985 Viral mRNA Translation top of list 0.0043RPL21,RPS19,RPS2,RPS26,RPS4X

CD8+ T cell 10CL:22502 Leber hereditary optic neuropathy top of list 0.0071MT-ATP6,MT-CO3,MT-CYB,MT-ND4


signaling

bottom of

list0.0073

BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,

SAMD9L,TRIM22,XAF1


CD4+ T cell 11CL:14978 Peptide chain elongation top of list 0.00028RPL13A,RPL3,RPL4,RPS2,RPS26,RPS27A,RPS4X



CD4+ T cell 11CL:14985 Viral mRNA Translation top of list 0.00053RPL13A,RPL3,RPS2,RPS26,RPS27A,RPS4X


signaling

bottom of

list0.00079

BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM2

2,XAF1



44 family

bottom of

list0.00079BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1






Megakaryocyte progenitor

cell12CL:22328 respirasome top of list 6.34E-05COX6A1,MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5


cell12CL:4665 Interferon alpha/beta signaling

bottom of

list0.00065BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1


cell12CL:4662


44 family

bottom of

list0.00088BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1


cell12CL:4661


signaling

bottom of

list0.00088

BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM22,XAF

1


cell12CL:22502 Leber hereditary optic neuropathy top of list 0.002MT-ATP6,MT-CO3,MT-CYB,MT-ND4


cell12CL:22332 mitochondrial respiratory chain complex I top of list 0.002MT-ND2,MT-ND3,MT-ND4L,MT-ND5


cell12CL:4670 type I interferon signaling pathway

bottom of



cell12CL:14982 Peptide chain elongation top of list 0.0035RPL13A,RPS2,RPS20,RPS26



bottom of



cell12CL:22408 Leber hereditary optic neuropathy top of list 0.0042MT-ND2,MT-ND4L,MT-ND5


cell12CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0042COX6A1,MT-ATP6,MT-CO3,MT-CYB,MT-ND4


cell12CL:14985 Viral mRNA Translation top of list 0.0091RPL13A,RPS2,RPS26

CD141+CLEC9A+

dendritic cell13CL:14983 Peptide chain elongation top of list 0.0072EEF2,RPL26,RPL36A,RPL6,RPS26

CD141+CLEC9A+

dendritic cell13CL:22328 respirasome top of list 0.0072MT-ATP6,MT-CO1,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L

CD141+CLEC9A+

dendritic cell13CL:4662


44 family

bottom of

list0.0076BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,SAMD9L,XAF1

CD141+CLEC9A+

dendritic cell13CL:4665 Interferon alpha/beta signaling

bottom of

list0.0076BST2,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,SAMD9L,XAF1

CD141+CLEC9A+



signaling

bottom of

list0.0076BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,SAMD9L,TRIM22,XAF1

CD141+CLEC9A+

dendritic cell13CL:18627 MHC class II protein complex, and dynactin complex both ends 0.0076HLA-DQA2,HLA-DQB1,HLA-DRB1,HLA-DRB5

CD141+CLEC9A+



signaling

bottom of

list0.0097

BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,SAMD9L,SP110,TRIM22

,XAF1


cell14CL:4659


signaling

bottom of

list1.25E-05

BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,RSAD2,SP110,T

RIM22,XAF1


cell14CL:4661


signaling

bottom of

list1.25E-05

BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,RSAD2,TRIM22,X

AF1



bottom of

list1.72E-05BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,RSAD2,XAF1


cell14CL:4662


44 family

bottom of

list1.72E-05BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,PLSCR1,RSAD2,XAF1



bottom of

list6.50E-05BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,RSAD2,XAF1



bottom of

list6.50E-05IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,RSAD2,XAF1


cell14CL:22502 Leber hereditary optic neuropathy top of list 0.00033MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4


cell14CL:9922

Formation of Fibrin Clot (Clotting Cascade), and platelet alpha

granule lumentop of list 0.007F13A1,PROS1,THBS1,TMSB4X


Protein exporttop of list 2.80E-07EEF1A1,EEF2,EIF1,EIF4B,PABPC1,RPL10A,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS26,RPS27A,RPS4X,RPS6



EEF1A1,EEF1B2,EEF2,EIF1,EIF4B,PABPC1,RPL10A,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS26,RPS27A,RPS

4X,RPS6,TPT1

CD1C+_B dendritic cell 15CL:14978 Peptide chain elongation top of list 1.38E-05EEF1A1,EEF2,RPL10A,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS26,RPS27A,RPS4X,RPS6

CD1C+_B dendritic cell 15CL:14982 Peptide chain elongation top of list 2.80E-05EEF2,RPL10A,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS26,RPS27A,RPS4X,RPS6

CD1C+_B dendritic cell 15CL:14983 Peptide chain elongation top of list 5.15E-05EEF2,RPL10A,RPL21,RPL26,RPL3,RPL6,RPS26,RPS27A,RPS4X,RPS6

CD1C+_B dendritic cell 15CL:14985 Viral mRNA Translation top of list 0.00013RPL10A,RPL21,RPL26,RPL3,RPL6,RPS26,RPS27A,RPS4X,RPS6

CD1C+_B dendritic cell 15CL:22328 respirasome top of list 0.00022MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD1C+_B dendritic cell 15CL:4665 Interferon alpha/beta signaling bottom of 0.00054BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1

list


list0.0012BST2,IFI27,IFI35,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1


list0.0012IFI27,IFI35,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1

CD8+ T cell 16CL:22328 respirasome top of list 4.00E-07COX6A1,COX6B1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,ND

UFA3

CD8+ T cell 16CL:22327 Oxidative phosphorylation top of list 4.00E-07ATP6V0E1,COX6A1,COX6B1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,M

T-ND4L,MT-ND5,NDUFA3

CD8+ T cell 16CL:22502 Leber hereditary optic neuropathy top of list 8.53E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD8+ T cell 16CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.00011COX6A1,COX6B1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4


list0.00022

BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF

1

CD8+ T cell 16CL:22332 mitochondrial respiratory chain complex I top of list 0.00045MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3








44 family

bottom of

list0.00096BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1



signaling

bottom of

list0.00096

BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM22,XAF

1


list0.00096BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

CD4+ T cell 17CL:14985 Viral mRNA Translation top of list 0.00096RPL21,RPL3,RPS2,RPS26,RPS4X


CD4+ T cell 17CL:4670 type I interferon signaling pathway bottom of 0.0054IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1

list



CD4+ T cell 17CL:22408 Leber hereditary optic neuropathy top of list 0.009MT-ND2,MT-ND4L,MT-ND5

CD4+ T helper 18CL:4665 Interferon alpha/beta signalingbottom of

list0.0026ADAR,BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

CD4+ T helper 18CL:4662Interferon alpha/beta signaling, and Interferon-induced protein

44 family

bottom of

list0.0026ADAR,BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

CD4+ T helper 18CL:4659Interferon alpha/beta signaling, and Interferon gamma

signaling

bottom of

list0.0026ADAR,BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,SP110,TRIM22,XAF1

CD4+ T helper 18CL:22327 Oxidative phosphorylation top of list 0.0026ATP5H,MT-CO1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,NDUFS5

CD4+ T helper 18CL:4661Interferon alpha/beta signaling, and Interferon gamma

signaling

bottom of

list0.0026ADAR,BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,TRIM22,XAF1

CD4+ T helper 18CL:14967GTP hydrolysis and joining of the 60S ribosomal subunit, and

Protein exporttop of list 0.0026EIF3L,EIF4B,RPL3,RPS26,RPS27A

CD4+ T helper 18CL:22328 respirasome top of list 0.0026MT-CO1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,NDUFS5

CD4+ T helper 18CL:14963GTP hydrolysis and joining of the 60S ribosomal subunit, and

Nonsense-mediated mRNA decaytop of list 0.0036EIF3L,EIF4B,EIF5A,RPL3,RPS26,RPS27A

CD141+CLEC9A+

dendritic cell19CL:14983 Peptide chain elongation top of list 0.00076EEF2,RPL17,RPL26,RPL3,RPL36A,RPL6,RPS26,RPS4X,RPS7

CD141+CLEC9A+

dendritic cell19CL:14978 Peptide chain elongation top of list 0.00076EEF2,RPL17,RPL26,RPL3,RPL36A,RPL4,RPL6,RPS26,RPS4X,RPS7

CD141+CLEC9A+

dendritic cell19CL:14985 Viral mRNA Translation top of list 0.0027RPL17,RPL26,RPL3,RPL6,RPS26,RPS4X,RPS7

CD141+CLEC9A+



signaling

bottom of

list3.39E-05

BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,RSAD2,TRIM

22,XAF1

CD141+CLEC9A+



44 family

bottom of

list3.39E-05BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,RSAD2,XAF1

CD141+CLEC9A+

dendritic cell20CL:22328 respirasome top of list 3.39E-05MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,UQCR10

CD141+CLEC9A+

dendritic cell20CL:4665 Interferon alpha/beta signaling

bottom of

list3.39E-05BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,RSAD2,XAF1

CD141+CLEC9A+

dendritic cell20CL:22327 Oxidative phosphorylation top of list 8.16E-05ATP6V0E1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,UQCR10

CD141+CLEC9A+

dendritic cell20CL:4670 type I interferon signaling pathway

bottom of

list0.00052IFI27,IFI35,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,RSAD2,XAF1

CD141+CLEC9A+

dendritic cell20CL:4668 type I interferon signaling pathway

bottom of

list0.00052BST2,IFI27,IFI35,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,RSAD2,XAF1

CD141+CLEC9A+

dendritic cell20CL:22502 Leber hereditary optic neuropathy top of list 0.00067MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD141+CLEC9A+

dendritic cell20CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0013MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4,UQCR10

CD141+CLEC9A+


GTP hydrolysis and joining of the 60S ribosomal subunit, and

Protein exporttop of list 0.0031EIF1,RPL21,RPS2,RPS26,RPS4X

CD141+CLEC9A+

dendritic cell20CL:22332 mitochondrial respiratory chain complex I top of list 0.0059MT-ND2,MT-ND3,MT-ND4L,MT-ND5

CD141+CLEC9A+

dendritic cell20CL:14985 Viral mRNA Translation top of list 0.0076RPL21,RPS2,RPS26,RPS4X

CD1C-CD141- dendritic

cell21CL:22328 respirasome top of list 1.51E-05MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10


cell21CL:22327 Oxidative phosphorylation top of list 1.51E-05

ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,

NDUFA3,UQCR10


cell21CL:4662


44 family

bottom of

list6.36E-05

EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS3,OASL,PLSCR1,RSAD2,

XAF1



bottom of

list6.36E-05IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS3,OASL,RSAD2,XAF1



bottom of

list0.00019IFI27,IFI35,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS3,OASL,RSAD2,XAF1


cell21CL:22502 Leber hereditary optic neuropathy top of list 0.00019MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4


cell21CL:4661


signaling

bottom of

list0.00019

EPSTI1,FCGR1A,GBP1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS3,O

ASL,PLSCR1,RSAD2,TRIM22,XAF1


cell21CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.00031MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4,UQCR10


cell21CL:14963


Nonsense-mediated mRNA decaytop of list 0.00031

EEF1A1,EEF1B2,EEF2,EIF3F,EIF3L,EIF4B,NACA,PABPC1,RPL10,RPL10A,RPL21,RPL28,RPL3,RPL4,RPL5,RPL6,RPS2,R

PS27L,RPS4X,RPS6


cell21CL:4659


signaling

bottom of

list0.00039

EPSTI1,FCGR1A,GBP1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF2BP2,IRF7,ISG15,ISG20,MT2A,MX1,MX2

,OAS3,OASL,PLSCR1,RSAD2,TRIM22,XAF1


cell21CL:14966


Protein exporttop of list 0.00045

EEF1A1,EEF1B2,EEF2,EIF3F,EIF3L,EIF4B,PABPC1,RPL10,RPL10A,RPL21,RPL28,RPL3,RPL4,RPL5,RPL6,RPS2,RPS27L,

RPS4X,RPS6


cell21CL:14967


Protein exporttop of list 0.00093

EEF1A1,EEF2,EIF3F,EIF3L,EIF4B,PABPC1,RPL10,RPL10A,RPL21,RPL28,RPL3,RPL4,RPL5,RPL6,RPS2,RPS27L,RPS4X,

RPS6


cell21CL:14978 Peptide chain elongation top of list 0.0088EEF1A1,EEF2,RPL10,RPL10A,RPL21,RPL28,RPL3,RPL4,RPL5,RPL6,RPS2,RPS27L,RPS4X,RPS6


cell21CL:22332 mitochondrial respiratory chain complex I top of list 0.0088MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3

CD8+ T cell 22CL:22327 Oxidative phosphorylation top of list 9.26E-05ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3

CD8+ T cell 22CL:22328 respirasome top of list 9.26E-05MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3


44 family

bottom of

list9.26E-05BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1


list9.26E-05BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1


list0.00099BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1

CD8+ T cell 22CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0012MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4



list0.0021IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1


CD4+ T cell 23CL:4662 Interferon alpha/beta signaling, and Interferon-induced proteinbottom of 0.0015BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

44 family list




CD4+ T cell 23CL:14985 Viral mRNA Translation top of list 0.0015RPL21,RPL3,RPS2,RPS26,RPS4X

CD4+ T cell 23CL:14978 Peptide chain elongation top of list 0.0015RPL21,RPL3,RPL4,RPS2,RPS26,RPS4X


signaling

bottom of

list0.0016BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,TRIM22,XAF1




T cell(Activated T cell) 24CL:14967GTP hydrolysis and joining of the 60S ribosomal subunit, and

Protein exporttop of list 7.36E-06EIF4B,RPL13,RPL13A,RPL21,RPL3,RPL4,RPS2,RPS26,RPS27A,RPS4X

T cell(Activated T cell) 24CL:14978 Peptide chain elongation top of list 1.50E-05RPL13,RPL13A,RPL21,RPL3,RPL4,RPS2,RPS26,RPS27A,RPS4X

T cell(Activated T cell) 24CL:14985 Viral mRNA Translation top of list 2.53E-05RPL13,RPL13A,RPL21,RPL3,RPS2,RPS26,RPS27A,RPS4X

T cell(Activated T cell) 24CL:22328 respirasome top of list 2.53E-05COX5A,MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

T cell(Activated T cell) 24CL:4670 type I interferon signaling pathwaybottom of

list0.00027IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1

T cell(Activated T cell) 24CL:4668 type I interferon signaling pathwaybottom of

list0.00027BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1

T cell(Activated T cell) 24CL:22502 Leber hereditary optic neuropathy top of list 0.00092MT-ATP6,MT-CO3,MT-CYB,MT-ND4

T cell(Activated T cell) 24CL:22332 mitochondrial respiratory chain complex I top of list 0.0011MT-ND2,MT-ND3,MT-ND4L,MT-ND5

T cell(Activated T cell) 24CL:22408 Leber hereditary optic neuropathy top of list 0.0051MT-ND2,MT-ND4L,MT-ND5

T cell(Activated T cell) 24CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0051COX5A,MT-ATP6,MT-CO3,MT-CYB,MT-ND4


cell25CL:22328 respirasome top of list 3.60E-07COX6A1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5


cell25CL:22327 Oxidative phosphorylation top of list 3.60E-07

ATP5J2,COX6A1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-

ND5


cell25CL:22502 Leber hereditary optic neuropathy top of list 4.56E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4



bottom of

list3.24E-05

BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF

1


cell25CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 3.60E-05COX6A1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4


cell25CL:22332 mitochondrial respiratory chain complex I top of list 0.00032MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5



bottom of

list0.00074BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1



bottom of

list0.0012IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1


cell25CL:22408 Leber hereditary optic neuropathy top of list 0.0018MT-ND1,MT-ND2,MT-ND4L,MT-ND5

T cell 26CL:22328 respirasome top of list 6.30E-05MT-ATP6,MT-CO3,MT-CYB,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

T cell 26CL:14967GTP hydrolysis and joining of the 60S ribosomal subunit, and

Protein exporttop of list 0.00015EIF4B,RPL13A,RPL27,RPS2,RPS26,RPS27A

T cell 26CL:14985 Viral mRNA Translation top of list 0.00038RPL13A,RPL27,RPS2,RPS26,RPS27A

T cell 26CL:4659Interferon alpha/beta signaling, and Interferon gamma

signaling

bottom of

list0.0006BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,SP110,TRIM22,XAF1

T cell 26CL:4661Interferon alpha/beta signaling, and Interferon gamma

signaling

bottom of

list0.0006BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,TRIM22,XAF1

T cell 26CL:4662Interferon alpha/beta signaling, and Interferon-induced protein

44 family

bottom of

list0.0006BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

T cell 26CL:4665 Interferon alpha/beta signalingbottom of

list0.0006BST2,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

T cell 26CL:22502 Leber hereditary optic neuropathy top of list 0.0016MT-ATP6,MT-CO3,MT-CYB,MT-ND4

T cell 26CL:4668 type I interferon signaling pathwaybottom of

list0.0046BST2,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1

T cell 26CL:4670 type I interferon signaling pathwaybottom of

list0.0046IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1

T cell 26CL:22332 mitochondrial respiratory chain complex I top of list 0.0057MT-ND3,MT-ND4L,MT-ND5


cell27CL:4662


44 family

bottom of

list3.49E-05BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,PLSCR1,RSAD2,XAF1


cell27CL:4661


signaling

bottom of

list3.49E-05

BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,RSAD2,TRIM22,X

AF1



bottom of

list0.00018BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,RSAD2,XAF1


cell27CL:4659


signaling

bottom of

list0.00051

BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF2,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,RSAD2,SP1

10,TRIM22,XAF1



bottom of

list0.00058BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,RSAD2,XAF1



bottom of

list0.00065IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,RSAD2,XAF1


cell27CL:1048 EF-hand, Ca insensitive, and Vinculin top of list 0.0039TLN1,VCL,ZYX

CD1C+_B dendritic cell 28CL:14983 Peptide chain elongation top of list 2.35E-07RPL13A,RPL21,RPLP2,RPS14,RPS2,RPS26,RPS27A,RPS4X,RPS7,RPS8

CD1C+_B dendritic cell 28CL:14978 Peptide chain elongation top of list 2.35E-07RPL10,RPL13A,RPL21,RPL34,RPLP2,RPS14,RPS2,RPS26,RPS27A,RPS4X,RPS7,RPS8

CD1C+_B dendritic cell 28CL:14982 Peptide chain elongation top of list 2.35E-07RPL10,RPL13A,RPL21,RPLP2,RPS14,RPS2,RPS26,RPS27A,RPS4X,RPS7,RPS8


Protein exporttop of list 2.35E-07EIF4B,RPL10,RPL13A,RPL21,RPL34,RPLP2,RPS14,RPS2,RPS26,RPS27A,RPS3,RPS4X,RPS7,RPS8

CD1C+_B dendritic cell 28CL:14985 Viral mRNA Translation top of list 3.76E-07RPL13A,RPL21,RPS14,RPS2,RPS26,RPS27A,RPS4X,RPS7,RPS8

CD1C+_B dendritic cell 28CL:4560immunoglobulin binding, and Immunoregulatory interactions

between a Lymphoid and a non-Lymphoid cell

bottom of

list0.0022FCER1G,S100A8,S100A9

CD1C+_B dendritic cell 28CL:4661Interferon alpha/beta signaling, and Interferon gamma

signaling

bottom of

list0.0031BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM22,XAF1

CD1C+_B dendritic cell 28CL:4659Interferon alpha/beta signaling, and Interferon gamma

signaling

bottom of

list0.0032

BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,SP110,TRIM22,XAF

1

CD1C+_B dendritic cell 28CL:4665 Interferon alpha/beta signalingbottom of

list0.0033BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1

CD1C+_B dendritic cell 28CL:4662Interferon alpha/beta signaling, and Interferon-induced protein

44 family

bottom of

list0.0041BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1

CD8+ T cell 29CL:22328 respirasome top of list 3.70E-07COX5B,COX7A2,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDU

FA3,NDUFB2

CD8+ T cell 29CL:22327 Oxidative phosphorylation top of list 3.70E-07ATP5E,ATP6V0E1,COX5B,COX7A2,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-

ND4,MT-ND4L,MT-ND5,NDUFA3,NDUFB2

CD8+ T cell 29CL:22502 Leber hereditary optic neuropathy top of list 2.71E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD8+ T cell 29CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 2.78E-05COX5B,COX7A2,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4


list4.29E-05BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1



list0.0017BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1

CD8+ T cell 29CL:22332 mitochondrial respiratory chain complex I top of list 0.0017MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3,NDUFB2


list0.0026IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1


44 family

bottom of

list0.0045

BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS2,OASL,PLSCR1,R

SAD2,XAF1


signaling

bottom of

list0.0049

BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OAS2,OASL,PLS

CR1,RSAD2,TRIM22,XAF1


cell30CL:22327 Oxidative phosphorylation top of list 6.19E-05ATP6V0E1,MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10


cell30CL:22328 respirasome top of list 6.19E-05MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10


cell30CL:4662


44 family

bottom of

list0.00083BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,RSAD2,XAF1


cell30CL:4661


signaling

bottom of

list0.00083BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,RSAD2,TRIM22,XAF1


cell30CL:4659


signaling

bottom of

list0.00096

BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,RSAD2,SP110,TRIM22,

XAF1



bottom of

list0.00096BST2,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,RSAD2,XAF1


cell30CL:22502 Leber hereditary optic neuropathy top of list 0.0018MT-ATP6,MT-CO3,MT-CYB,MT-ND4


cell30CL:22332 mitochondrial respiratory chain complex I top of list 0.0051MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3


cell30CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0051MT-ATP6,MT-CO3,MT-CYB,MT-ND4,UQCR10


cell30CL:22408 Leber hereditary optic neuropathy top of list 0.0087MT-ND2,MT-ND4L,MT-ND5

CD8 cytoxict cells 31CL:22328 respirasome top of list 3.80E-07MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,UQCR10

CD8 cytoxict cells 31CL:22327 Oxidative phosphorylation top of list 3.80E-07ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,

UQCR10

CD8 cytoxict cells 31CL:4665 Interferon alpha/beta signalingbottom of

list1.90E-05

BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,SAMD9L,

XAF1

CD8 cytoxict cells 31CL:22502 Leber hereditary optic neuropathy top of list 2.09E-05MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD8 cytoxict cells 31CL:14967GTP hydrolysis and joining of the 60S ribosomal subunit, and

Protein exporttop of list 8.97E-05EIF1,EIF4B,RPL13,RPL13A,RPL21,RPL26,RPL36A,RPS19,RPS2,RPS26,RPS27,RPS27A,RPS4X

CD8 cytoxict cells 31CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.00015MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4,UQCR10

CD8 cytoxict cells 31CL:4668 type I interferon signaling pathwaybottom of


CD8 cytoxict cells 31CL:14982 Peptide chain elongation top of list 0.00018RPL13,RPL13A,RPL21,RPL26,RPL36A,RPS19,RPS2,RPS26,RPS27,RPS27A,RPS4X

CD8 cytoxict cells 31CL:14983 Peptide chain elongation top of list 0.00025RPL13,RPL13A,RPL21,RPL26,RPL36A,RPS19,RPS2,RPS26,RPS27A,RPS4X

CD8 cytoxict cells 31CL:4670 type I interferon signaling pathwaybottom of


CD8 cytoxict cells 31CL:14985 Viral mRNA Translation top of list 0.00046RPL13,RPL13A,RPL21,RPL26,RPS19,RPS2,RPS26,RPS27A,RPS4X

CD8 cytoxict cells 31CL:22332 mitochondrial respiratory chain complex I top of list 0.00082MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5

CD8 cytoxict cells 31CL:22408 Leber hereditary optic neuropathy top of list 0.0025MT-ND1,MT-ND2,MT-ND4L,MT-ND5

CD8 cytoxict cells 34CL:4662Interferon alpha/beta signaling, and Interferon-induced protein

44 family

bottom of

list0.00054DDX60,EPSTI1,GBP2,IFI44L,IFI6,IFIT3,ISG15,ISG20,MX2,OAS3,USP18

CD8 cytoxict cells 34CL:4665 Interferon alpha/beta signalingbottom of

list0.00065DDX60,GBP2,IFI44L,IFI6,IFIT3,ISG15,ISG20,MX2,OAS3,USP18

CD8+ T cell 37CL:14966GTP hydrolysis and joining of the 60S ribosomal subunit, and

Protein exporttop of list 0.0031RPL3,RPS26,RPS4X,TPT1

CD8+ T cell 37CL:14985 Viral mRNA Translation top of list 0.0054RPL3,RPS26,RPS4X


44 family

bottom of

list0.0073BST2,EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS3,PLSCR1,XAF1


signaling

bottom of

list0.0073BST2,EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OAS3,PLSCR1,TRIM22,XAF1


list0.0073BST2,IFI27,IFI44L,IFI6,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS3,XAF1

Plasmacytoid dendritic

cell43CL:14983 Peptide chain elongation top of list 0.01RPL26,RPL36A,RPS26

Table S5 Compared with the normal controls, significant enriched pathways of each cell subtypes in the moderate condition (patient 3, 4, 5, 6, 7and 8)

typeclus

ter#term ID term description direction

false

discov

ery rate


Activated

CD4+ T cell2CL:4665 Interferon alpha/beta signaling bottom of list 0.0017IFI44L,IFI6,IFITM1,ISG15,MX1,XAF1

Activated

CD4+ T cell2CL:22328 respirasome top of list 0.0035MT-ATP6,MT-CO3,MT-CYB,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD8+ T cell 3CL:2482AP-1 transcription factor, and Transcription

factor Junbottom of list 0.0071FOS,JUN,JUNB

CD8+ T cell 3CL:2403




bottom of list 0.0071DUSP1,FOS,IER2,JUN,JUNB

CD8+ T cell 3CL:2481bZIP transcription factor, and Early growth

response, N-terminalbottom of list 0.0096FOS,IER2,JUN,JUNB

Megakaryocyt

e progenitor

cell

4CL:4665 Interferon alpha/beta signaling bottom of list 0.00096IFI27,IFI44L,IFI6,IFITM1,ISG15

CD141+CLEC

9A+ dendritic

cell

5CL:4665 Interferon alpha/beta signaling bottom of list 0.00091IFI44L,IFIT3,IFITM1,ISG15,XAF1

CD141+CLEC

9A+ dendritic

cell

5CL:2403





CD141+CLEC

9A+ dendritic

cell

5CL:2481bZIP transcription factor, and Early growth


CD141+CLEC

9A+ dendritic5CL:4670 type I interferon signaling pathway bottom of list 0.0066IFIT3,IFITM1,XAF1

cell

CD141+CLEC

9A+ dendritic

cell

5CL:22328 respirasome top of list 0.0066MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND3,MT-ND4,MT-ND4L

CD1C+_B


GTP hydrolysis and joining of the 60S

ribosomal subunit, and Protein exporttop of list 0.00019EEF1A1,EEF2,EIF3L,EIF4B,PABPC1,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL4,RPL5,RPL6,RPLP0,RPLP1,RPS23,RPS26,RPS4X,RPS6,RPS8

CD1C+_B

dendritic cell6CL:14978 Peptide chain elongation top of list 0.00057EEF1A1,EEF2,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL4,RPL5,RPL6,RPLP0,RPLP1,RPS23,RPS26,RPS4X,RPS6,RPS8

CD1C+_B

dendritic cell6CL:4670 type I interferon signaling pathway bottom of list 0.0006IFI27,IFI6,IFITM1,IFITM2,IFITM3,MX1

CD1C+_B

dendritic cell6CL:14982 Peptide chain elongation top of list 0.0006EEF2,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL5,RPL6,RPLP0,RPLP1,RPS23,RPS26,RPS4X,RPS6,RPS8

CD1C+_B

dendritic cell6CL:4665 Interferon alpha/beta signaling bottom of list 0.0006IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1

CD1C+_B


Interferon alpha/beta signaling, and

Interferon-induced protein 44 familybottom of list 0.0006EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1

CD1C+_B



Interferon gamma signalingbottom of list 0.0006EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MT2A,MX1

CD1C+_B

dendritic cell6CL:14983 Peptide chain elongation top of list 0.0034EEF2,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL6,RPS23,RPS26,RPS4X,RPS6,RPS8

CD1C+_B



ribosomal subunit, and Protein exporttop of list 0.0059

EEF1A1,EEF1B2,EEF2,EIF3L,EIF4B,PABPC1,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL4,RPL5,RPL6,RPLP0,RPLP1,RPS23,RPS26,RPS4X,RPS6,RPS8,

TPT1

CD1C+_B

dendritic cell6CL:14985 Viral mRNA Translation top of list 0.0093RPL13,RPL15,RPL26,RPL3,RPL6,RPS23,RPS26,RPS4X,RPS6,RPS8

Plasmacytoid

dendritic cell7CL:4665 Interferon alpha/beta signaling bottom of list 0.0013BST2,IFI44L,IFI6,IFITM1,IFITM3,IRF7,ISG15,MX1,XAF1

Plasmacytoid

dendritic cell7CL:4668 type I interferon signaling pathway bottom of list 0.006BST2,IFI6,IFITM1,IFITM3,IRF7,MX1,XAF1

Plasmacytoid

dendritic cell7CL:4670 type I interferon signaling pathway bottom of list 0.0077IFI6,IFITM1,IFITM3,IRF7,MX1,XAF1

CD1C+_B

dendritic cell8CL:4665 Interferon alpha/beta signaling bottom of list 0.0013IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1,XAF1

CD1C+_B



Interferon gamma signalingbottom of list 0.0013EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MT2A,MX1,XAF1

CD1C+_B



ribosomal subunit, and Protein exporttop of list 0.0013EEF1A1,EEF2,EIF4B,PABPC1,RPL13,RPL26,RPL3,RPL6,RPLP0,RPLP1,RPS26,RPS6

CD1C+_B



ribosomal subunit, and Protein exporttop of list 0.0013EEF1A1,EEF2,EIF4B,PABPC1,RPL13,RPL26,RPL3,RPL6,RPLP0,RPLP1,RPS26,RPS6,TPT1

CD1C+_B



Interferon-induced protein 44 familybottom of list 0.0014EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1,XAF1

CD1C+_B

dendritic cell8CL:4670 type I interferon signaling pathway bottom of list 0.0023IFI27,IFI6,IFITM1,IFITM2,IFITM3,MX1,XAF1

CD1C+_B

dendritic cell8CL:14978 Peptide chain elongation top of list 0.0024EEF1A1,EEF2,RPL13,RPL26,RPL3,RPL6,RPLP0,RPLP1,RPS26,RPS6

CD1C+_B

dendritic cell8CL:14982 Peptide chain elongation top of list 0.0034EEF2,RPL13,RPL26,RPL3,RPL6,RPLP0,RPLP1,RPS26,RPS6

CD4+ T cell 9CL:4665 Interferon alpha/beta signaling bottom of list 0.0013IFI44L,IFI6,IFITM1,ISG15,XAF1

CD8+ T cell 10CL:4665 Interferon alpha/beta signaling bottom of list 0.0026IFI44L,IFITM1,ISG15,XAF1

Plasmacytoid

dendritic cell12CL:4665 Interferon alpha/beta signaling bottom of list 0.00041BST2,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1

Plasmacytoid

dendritic cell12CL:4668 type I interferon signaling pathway bottom of list 0.0046BST2,IFI6,IFITM1,IFITM3,MX1,XAF1

Plasmacytoid

dendritic cell12CL:4670 type I interferon signaling pathway bottom of list 0.0074IFI6,IFITM1,IFITM3,MX1,XAF1

CD8+ T cell 13CL:4665 Interferon alpha/beta signaling bottom of list 0.00058IFI44L,IFI6,IFITM1,ISG15,MX1,XAF1

CD8+ T cell 13CL:4670 type I interferon signaling pathway bottom of list 0.0079IFI6,IFITM1,MX1,XAF1

Megakaryocyt

e progenitor

cell

14CL:14966GTP hydrolysis and joining of the 60S

ribosomal subunit, and Protein exporttop of list 0.0021EEF1A1,EIF3L,EIF4B,RPL13,RPL13A,RPL21,RPL3,RPLP1,RPS12,RPS14,RPS18,RPS19,RPS23,RPS3,RPS4X,RPS6,TPT1

Megakaryocyt 14CL:22502 Leber hereditary optic neuropathy top of list 0.0021MT-ATP6,MT-CO3,MT-CYB,MT-ND4

e progenitor

cell

Megakaryocyt

e progenitor

cell

14CL:4661Interferon alpha/beta signaling, and

Interferon gamma signalingbottom of list 0.0025IFI27,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MT2A

Megakaryocyt

e progenitor

cell

14CL:4665 Interferon alpha/beta signaling bottom of list 0.0025IFI27,IFI6,IFITM1,IFITM2,IFITM3,ISG15

Megakaryocyt

e progenitor

cell


ribosomal subunit, and Protein exporttop of list 0.0025EEF1A1,EIF3L,EIF4B,RPL13,RPL13A,RPL21,RPL3,RPLP1,RPS12,RPS14,RPS18,RPS19,RPS23,RPS3,RPS4X,RPS6

Megakaryocyt

e progenitor

cell

14CL:14978 Peptide chain elongation top of list 0.0056EEF1A1,RPL13,RPL13A,RPL21,RPL3,RPLP1,RPS12,RPS14,RPS18,RPS19,RPS23,RPS4X,RPS6

Megakaryocyt

e progenitor

cell

14CL:14982 Peptide chain elongation top of list 0.0092RPL13,RPL13A,RPL21,RPL3,RPLP1,RPS12,RPS14,RPS18,RPS19,RPS23,RPS4X,RPS6

Effector CD8+

memory T

(Tem) cell

16CL:4665 Interferon alpha/beta signaling bottom of list 0.00031BST2,IFI44L,IFI6,IFITM1,IFITM3,IRF1,ISG15,MX1,XAF1

Effector CD8+

memory T

(Tem) cell

16CL:4668 type I interferon signaling pathway bottom of list 0.0023BST2,IFI6,IFITM1,IFITM3,IRF1,MX1,XAF1

Effector CD8+

memory T

(Tem) cell

16CL:4670 type I interferon signaling pathway bottom of list 0.0023IFI6,IFITM1,IFITM3,MX1,XAF1

CD8+ T cell 18CL:22328 respirasome top of list 0.0026MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

Megakaryocyt

e progenitor

cell

20CL:22502 Leber hereditary optic neuropathy top of list 0.00058MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

Megakaryocyt 20CL:22446 cytochrome complex, and Cytochrome c top of list 0.00058MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4

e progenitor

cell

oxidase subunit VII

Megakaryocyt

e progenitor

cell

20CL:4665 Interferon alpha/beta signaling bottom of list 0.0027IFI27,IFI44L,IFI6,IFITM3

Megakaryocyt

e progenitor

cell

20CL:22328 respirasome top of list 0.003MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA6

Megakaryocyt

e progenitor

cell

20CL:22327 Oxidative phosphorylation top of list 0.0033MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA6

Megakaryocyt

e progenitor

cell

20CL:4670 type I interferon signaling pathway bottom of list 0.0033IFI27,IFI6,IFITM3

CD1C-CD141-

dendritic cell22CL:4665 Interferon alpha/beta signaling bottom of list 0.0024IFI44L,IFITM1,IFITM2,IFITM3,ISG15,XAF1

CD1C-CD141-



Interferon gamma signalingbottom of list 0.0052IFI44L,IFITM1,IFITM2,IFITM3,ISG15,MT2A,XAF1

CD1C-CD141-

dendritic cell22CL:4670 type I interferon signaling pathway bottom of list 0.0082IFITM1,IFITM2,IFITM3,XAF1

Naive CD8+ T

cell24CL:4665 Interferon alpha/beta signaling bottom of list 0.0097IFI44L,IFITM1,ISG15,XAF1

CD8+ T cell 25CL:4665 Interferon alpha/beta signaling bottom of list 0.0029IFI44L,IFITM1,ISG15,MX1

CD1C-CD141-

dendritic cell26CL:22328 respirasome top of list 0.00086MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD1C-CD141-



Interferon-induced protein 44 familybottom of list 0.0021EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1

CD1C-CD141-

dendritic cell26CL:4665 Interferon alpha/beta signaling bottom of list 0.0021IFI27,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1

CD1C-CD141-


CD141+CLEC

9A+ dendritic

cell


Interferon gamma signalingbottom of list 0.00052EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MT2A,MX1,XAF1

CD141+CLEC

9A+ dendritic

cell

28CL:4665 Interferon alpha/beta signaling bottom of list 0.00052IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1,XAF1

CD141+CLEC

9A+ dendritic

cell


Interferon-induced protein 44 familybottom of list 0.00052EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1,XAF1

CD141+CLEC

9A+ dendritic

cell


ribosomal subunit, and Protein exporttop of list 0.00052EEF1A1,EEF1B2,EEF2,EIF3L,EIF4B,PABPC1,RPL13,RPL26,RPL3,RPL36A,RPL4,RPLP0,RPS26,RPS6,TPT1

CD141+CLEC

9A+ dendritic

cell

28CL:4670 type I interferon signaling pathway bottom of list 0.00072IFI27,IFI6,IFITM1,IFITM2,IFITM3,MX1,XAF1

CD141+CLEC

9A+ dendritic

cell


ribosomal subunit, and Protein exporttop of list 0.00084EEF1A1,EEF2,EIF3L,EIF4B,PABPC1,RPL13,RPL26,RPL3,RPL36A,RPL4,RPLP0,RPS26,RPS6

CD141+CLEC

9A+ dendritic

cell

28CL:14978 Peptide chain elongation top of list 0.0077EEF1A1,EEF2,RPL13,RPL26,RPL3,RPL36A,RPL4,RPLP0,RPS26,RPS6

CD141+CLEC

9A+ dendritic

cell

29CL:4665 Interferon alpha/beta signaling bottom of list5.52E-0

5IFI44L,IFITM1,IRF7,ISG15,XAF1

CD141+CLEC

9A+ dendritic

cell

29CL:4670 type I interferon signaling pathway bottom of list 0.0041IFITM1,IRF7,XAF1

CD141+CLEC

9A+ dendritic

cell

29CL:22502 Leber hereditary optic neuropathy top of list 0.0041MT-CO1,MT-CO3,MT-CYB,MT-ND4

Megakaryocyt 30CL:22328 respirasome top of list 0.0036MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4,MT-ND4L,MT-ND5

e progenitor

cell

Megakaryocyt

e progenitor

cell

30CL:4665 Interferon alpha/beta signaling bottom of list 0.0084IFI27,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1

Megakaryocyt

e progenitor

cell

30CL:22502 Leber hereditary optic neuropathy top of list 0.0092MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

Megakaryocyt

e progenitor

cell


ribosomal subunit, and Protein exporttop of list 0.00025EIF4B,RPL13,RPL13A,RPL21,RPL23A,RPL3,RPL6,RPS14,RPS16,RPS18,RPS19,RPS23,RPS3,RPS3A,RPS4X,RPS5,RPS6,RPS8,TPT1

Megakaryocyt

e progenitor

cell


ribosomal subunit, and Protein exporttop of list 0.00027EIF4B,RPL13,RPL13A,RPL21,RPL23A,RPL3,RPL6,RPS14,RPS16,RPS18,RPS19,RPS23,RPS3,RPS3A,RPS4X,RPS5,RPS6,RPS8

Megakaryocyt

e progenitor

cell

31CL:14985 Viral mRNA Translation top of list 0.00046RPL13,RPL13A,RPL21,RPL23A,RPL3,RPL6,RPS14,RPS16,RPS18,RPS19,RPS23,RPS3A,RPS4X,RPS5,RPS6,RPS8

Megakaryocyt

e progenitor

cell

31CL:22328 respirasome top of list 0.0005MT-ATP6,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND4,MT-ND4L,MT-ND5

Megakaryocyt

e progenitor

cell

31CL:22502 Leber hereditary optic neuropathy top of list 0.00084MT-ATP6,MT-CO3,MT-CYB,MT-ND4

Megakaryocyt

e progenitor

cell

31CL:22446cytochrome complex, and Cytochrome c

oxidase subunit VIItop of list 0.0011MT-ATP6,MT-CO2,MT-CO3,MT-CYB,MT-ND4

Megakaryocyt

e progenitor

cell


Interferon-induced protein 44 familybottom of list 0.0017EPSTI1,IFI27,IFI6,IFITM3

Megakaryocyt

e progenitor31CL:4670 type I interferon signaling pathway bottom of list 0.0033IFI27,IFI6,IFITM3

cell

CD8+ T cell 32CL:22328 respirasome top of list 0.0069MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD8+ T cell 32CL:22446cytochrome complex, and Cytochrome c

oxidase subunit VIItop of list 0.0075MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4


CD1C+_B

dendritic cell33CL:14978 Peptide chain elongation top of list

8.27E-0

6

EEF1A1,FAU,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL32,RPL34,RPL35A,RPL36A,RPL39,

RPL5,RPL6,RPL7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27,RPS27A,RPS28,R

PS3A,RPS4X,RPS5,RPS6,RPS7,RPS8

CD1C+_B


8.27E-0

6

EEF1A1,FAU,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL30,RPL32,RPL34,RPL35A,RPL36A,

RPL39,RPL5,RPL6,RPL7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27,RPS27A,RP

S28,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8

CD1C+_B



ribosomal subunit, and Protein exporttop of list

8.27E-0

6

EEF1A1,EIF1,EIF4B,FAU,PABPC1,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL30,RPL32,RPL

34,RPL35A,RPL36A,RPL39,RPL5,RPL6,RPL7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS2

6,RPS27,RPS27A,RPS28,RPS3,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8,RPSA

CD1C+_B



ribosomal subunit, and Protein exporttop of list

8.27E-0

6

EEF1A1,EEF1B2,EIF1,EIF4B,FAU,PABPC1,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL30,RP

L32,RPL34,RPL35A,RPL36A,RPL39,RPL5,RPL6,RPL7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS

23,RPS26,RPS27,RPS27A,RPS28,RPS3,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8,RPSA,TPT1

CD1C+_B


1.10E-0

5

FAU,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL32,RPL35A,RPL36A,RPL39,RPL5,RPL6,RPL

7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27,RPS27A,RPS28,RPS3A,RPS4X,RP

S5,RPS6,RPS7,RPS8

CD1C+_B


1.18E-0

5

FAU,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL32,RPL35A,RPL36A,RPL39,RPL5,RPL6,RPL7A,RPL

9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27,RPS27A,RPS28,RPS3A,RPS4X,RPS5,RPS

6,RPS7,RPS8

CD1C+_B


3.79E-0

5

FAU,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL32,RPL35A,RPL36A,RPL39,RPL6,RPL7A,RPL9,RPLP2,RP

S12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27A,RPS28,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8

CD1C+_B


specific granule lumen, and azurophil

granule lumenbottom of list

4.70E-0

5CAMP,CST3,CTSS,GRN,LCN2,LTF,LYZ,MNDA,OLFM4,RETN

CD1C+_B


specific granule lumen, and Vitamin B6

metabolismbottom of list

6.01E-0

5CAMP,CST3,CTSS,LCN2,LTF,LYZ,OLFM4

CD1C+_B

dendritic cell33CL:14985 Viral mRNA Translation top of list

6.09E-0

5

FAU,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL35A,RPL39,RPL6,RPL7A,RPL9,RPS12,RPS13,RPS14,RPS

15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27A,RPS28,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8

CD1C+_B

dendritic cell33CL:4615 neutrophil aggregation, and Aquaporin 9 bottom of list 0.00028S100A12,S100A8,S100A9

CD1C+_B


immunoglobulin binding, and


Lymphoid and a non-Lymphoid cell

bottom of list 0.0004CD14,FCER1G,S100A12,S100A8,S100A9,TYROBP

CD1C+_B


mixed, incl. antigen receptor-mediated

signaling pathway, and Immunoregulatory

interactions between a Lymphoid and a

non-Lymphoid cell

bottom of list 0.00051CD14,FCER1G,S100A12,S100A8,S100A9,SPI1,TYROBP

CD1C+_B



neutrophil aggregationbottom of list 0.00057CD14,S100A12,S100A8,S100A9,TYROBP

CD1C+_B

dendritic cell33CL:10251 specific granule lumen bottom of list 0.00097CAMP,CST3,CTSS,LTF,LYZ,OLFM4

CD1C+_B

dendritic cell33CL:10260 specific granule lumen bottom of list 0.0017CAMP,LTF,LYZ,OLFM4

CD1C-CD141-

dendritic cell34CL:22327 Oxidative phosphorylation top of list 0.00062MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD1C-CD141-

dendritic cell34CL:22328 respirasome top of list 0.00062MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD1C-CD141-

dendritic cell34CL:4665 Interferon alpha/beta signaling bottom of list 0.0011IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,ISG15,MX1,XAF1

CD1C-CD141-



Interferon-induced protein 44 familybottom of list 0.0011EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,ISG15,MX1,PLSCR1,XAF1

CD1C-CD141-



Interferon gamma signalingbottom of list 0.0011EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,ISG15,MT2A,MX1,PLSCR1,XAF1

CD1C-CD141-

dendritic cell34CL:4670 type I interferon signaling pathway bottom of list 0.0033IFI27,IFI6,IFIT3,IFITM1,IFITM3,MX1,XAF1

CD1C-CD141-


cytochrome complex, and Cytochrome c

oxidase subunit VIItop of list 0.0066MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4

CD1C-CD141-


T cell 36CL:4665 Interferon alpha/beta signaling bottom of list 0.00049IFI27,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1

T cell 36CL:4670 type I interferon signaling pathway bottom of list 0.0034IFI27,IFI6,IFITM1,IFITM3,MX1,XAF1

CD8+ T cell 37CL:4665 Interferon alpha/beta signaling bottom of list 0.00017BST2,IFI27,IFI44L,IFI6,IFITM1,ISG15,ISG20,MX1,XAF1

CD8+ T cell 37CL:4668 type I interferon signaling pathway bottom of list 0.0021BST2,IFI27,IFI6,IFITM1,ISG20,MX1,XAF1

CD8+ T cell 37CL:4670 type I interferon signaling pathway bottom of list 0.0038IFI27,IFI6,IFITM1,ISG20,MX1,XAF1

Plasmacytoid

dendritic cell39CL:4665 Interferon alpha/beta signaling bottom of list 0.0021IFI27,IFI6,IFITM1,ISG15

Plasmacytoid

dendritic cell39CL:4670 type I interferon signaling pathway bottom of list 0.0079IFI27,IFI6,IFITM1

Megakaryocyt

e progenitor

cell

40CL:4665 Interferon alpha/beta signaling bottom of list 0.00068IFI27,IFI44L,IFI6,IFITM1,ISG15

Megakaryocyt

e progenitor

cell

40CL:4670 type I interferon signaling pathway bottom of list 0.006IFI27,IFI6,IFITM1



CD8+ T cell 44CL:2403











Plasmacytoid





bottom of list 0.00064DUSP1,FOS,FOSB,IER2,JUN,JUNB

Plasmacytoid 47CL:4665 Interferon alpha/beta signaling bottom of list 0.0011IFI27,IFI44L,IFITM1,IFITM3,ISG15,MX1,XAF1

dendritic cell

Plasmacytoid


bZIP transcription factor, and Early growth

response, N-terminalbottom of list 0.0011FOS,FOSB,IER2,JUN,JUNB

Plasmacytoid


peptide antigen assembly with MHC class II

protein complextop of list 0.003CD74,HLA-DMA,HLA-DMB,HLA-DRA,HLA-DRB1

Plasmacytoid


AP-1 transcription factor, and Transcription

factor Junbottom of list 0.0038FOS,FOSB,JUN,JUNB

Plasmacytoid

dendritic cell47CL:18630 MHC class II protein complex top of list 0.0051CD74,HLA-DMA,HLA-DMB,HLA-DPA1,HLA-DPB1,HLA-DQA1,HLA-DQB1,HLA-DRA,HLA-DRB1

Plasmacytoid

dendritic cell47CL:4670 type I interferon signaling pathway bottom of list 0.0097IFI27,IFITM1,IFITM3,MX1,XAF1

T cell 48CL:4212



Cytolysis

bottom of list 0.0044GNLY,HCST,NKG7

T cell 48CL:4665 Interferon alpha/beta signaling bottom of list 0.0044BST2,IFI27,IFI44L,IFI6,IFITM1,ISG15

T cell 48CL:4661Interferon alpha/beta signaling, and

Interferon gamma signalingbottom of list 0.0044BST2,IFI27,IFI44L,IFI6,IFITM1,ISG15,MT2A

AXL+SIGLEC

6+ dendritic

cell


ribosomal subunit, and Protein exporttop of list 0.0069EEF1B2,EEF2,RPL26,RPL36A

Table S6 Compared with the normal controls, significant entriched pathways of each cell (sub)types in cured patients

type Cluster #term ID term description direction false discovery rate matching proteins in your input (labels)


mixed, incl. MAPK targets/

Nuclear events mediated by

MAP kinases, and bZIP Maf


top of list 7.48E-05 DUSP1,FOS,JUN,JUNB

CD4+ T cell 4 CL:2482AP-1 transcription factor, and

Transcription factor Juntop of list 0.00029 FOS,JUN,JUNB

CD1C+_B

dendritic cell9 CL:4665 Interferon alpha/beta signaling

bottom of

list0.0055 IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1

CD1C+_B


Interferon alpha/beta signaling,

and Interferon-induced protein

44 family

bottom of

list0.0055 EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1

CD1C+_B






top of list 0.0057 ATF3,DUSP1,FOS,FOSB,IER2,JUN,JUNB

Effector CD8+

memory T (Tem)

cell

10 CL:2403





top of list 0.0037 DUSP1,FOS,JUN






top of list 0.0014 DUSP1,FOS,JUN,JUNB







top of list 0.00062 DUSP1,DUSP2,FOS,JUN,JUNB




Megakaryocyte

progenitor cell13 CL:18630 MHC class II protein complex

bottom of

list0.00033 CD74,HLA-DPA1,HLA-DPB1,HLA-DRA,HLA-DRB1,HLA-DRB5

Megakaryocyte

progenitor cell13 CL:18633

peptide antigen assembly with

MHC class II protein complex

bottom of

list0.00095 CD74,HLA-DRA,HLA-DRB1

Megakaryocyte


MHC class II protein complex,

and dynactin complex

bottom of

list0.00095 CD74,HLA-DPA1,HLA-DPB1,HLA-DRA,HLA-DRB1,HLA-DRB5,RCSD1

Megakaryocyte















Memory B cell 18 CL:2403






Memory B cell 18 CL:2482AP-1 transcription factor, and


Plasmacytoid


mixed, incl. regulation of TOR

signaling, and MAPK targets/


MAP kinases

top of list 0.00027 DDIT4,DUSP1,DUSP2,FOS,JUN,JUNB

Plasmacytoid



Nuclear events mediated bytop of list 0.00027 DUSP1,DUSP2,FOS,JUN,JUNB



Plasmacytoid


AP-1 transcription factor, and










T cell 24 CL:2403






T cell 24 CL:2482AP-1 transcription factor, and










CD8+ T cell 27 CL:18630 MHC class II protein complexbottom of

list0.0072 CD74,HLA-DPA1,HLA-DPB1,HLA-DRA,HLA-DRB1,HLA-DRB5

CD8+ T cell 27 CL:14967

GTP hydrolysis and joining of

the 60S ribosomal subunit, and

Protein export

top of list 0.0074 EIF1,RPL13A,RPS2,RPS20,RPS26

CD8+ T cell 27 CL:18627MHC class II protein complex,


bottom of

list0.0074 CD74,HLA-DPA1,HLA-DPB1,HLA-DQA2,HLA-DRA,HLA-DRB1,HLA-DRB5

CD141+CLEC9A

+ dendritic cell30 CL:2190

mixed, incl. regulation of TOR

signaling, and MAPK targets/top of list 0.0086 DDIT4,DUSP1,DUSP2,FOS,IER2,JUNB,NR4A1,PRKCD


MAP kinases

CD141+CLEC9A

+ dendritic cell30 CL:2403





top of list 0.0086 DUSP1,DUSP2,FOS,IER2,JUNB,NR4A1

Effector CD8+

memory T (Tem)

cell

32 CL:4211

Immunoregulatory interactions

between a Lymphoid and a

non-Lymphoid cell, and

Cytolysis

bottom of

list0.0016 CD2,HLA-B,PRF1

CD1C-CD141-




bottom of

list0.0018 CD74,HLA-DMA,HLA-DPA1,HLA-DPB1,HLA-DQA2,HLA-DRA,HLA-DRB1,HLA-DRB5,RCSD1

CD1C-CD141-






top of list 0.0018 DUSP1,FOS,FOSB,IER2,JUN,JUND

CD1C-CD141-




bottom of

list0.0018 CD74,HLA-DMA,HLA-DPA1,HLA-DPB1,HLA-DQA2,HLA-DRA,HLA-DRB1,HLA-DRB5

CD1C-CD141-

dendritic cell34 CL:18630 MHC class II protein complex

bottom of

list0.0027 CD74,HLA-DMA,HLA-DPA1,HLA-DPB1,HLA-DRA,HLA-DRB1,HLA-DRB5

CD1C-CD141-



Transcription factor Juntop of list 0.0031 FOS,FOSB,JUN,JUND

CD1C-CD141-


bZIP transcription factor, and

Early growth response,

N-terminal

top of list 0.0031 FOS,FOSB,IER2,JUN,JUND

CD1C+_B







CD1C+_B












Megakaryocyte

progenitor cell41 CL:14982 Peptide chain elongation top of list 0.0093 RPL13A,RPL17,RPL18A,RPL26,RPS11,RPS2,RPS20






top of list 7.77E-05 DUSP1,DUSP2,FOS,JUN,JUNB



AXL+SIGLEC6+

dendritic cell43 CL:14976 Peptide chain elongation top of list 8.75E-05

EEF1A1,EEF2,GNB2L1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL36AL,RPL37,RPL5,RPL7,RP

L9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,UBA52

AXL+SIGLEC6+


EEF2,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL29,RPL31,RPL32,RPL35A,RPL37,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,RPS15A,R

PS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,UBA52

AXL+SIGLEC6+




Protein export

top of list 8.75E-05

EEF1A1,EEF1B2,EEF2,EIF2S3,GNB2L1,PABPC1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL36

AL,RPL37,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3,RPS3A,RPS4X,RPS6,RPS7,RPS8,RPSA,SEC11A,SEC

11C,SPCS1,TPT1,UBA52

AXL+SIGLEC6+


EEF2,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL37,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,R

PS15A,RPS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,UBA52

AXL+SIGLEC6+


EEF1A1,EEF2,GNB2L1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL37,RPL5,RPL7,RPL9,RPLP1,

RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,UBA52

AXL+SIGLEC6+




Protein export

top of list 0.00011

EEF1A1,EEF2,EIF2S3,GNB2L1,PABPC1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL36AL,RPL3

7,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3,RPS3A,RPS4X,RPS6,RPS7,RPS8,RPSA,SEC11A,SEC11C,SP

CS1,UBA52

AXL+SIGLEC6+




Nonsense-mediated mRNA

top of list 0.00013

BTF3,EEF1A1,EEF1B2,EEF2,EIF2S3,GNB2L1,PABPC1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,

RPL36AL,RPL37,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3,RPS3A,RPS4X,RPS6,RPS7,RPS8,RPSA,SEC11

A,SEC11C,SPCS1,TPT1,UBA52

decay

AXL+SIGLEC6+

dendritic cell43 CL:14983 Peptide chain elongation top of list 0.00023

EEF2,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL29,RPL32,RPL35A,RPL37,RPL7,RPL9,RPS12,RPS14,RPS15A,RPS2,RPS23,RPS3A,RPS4X,

RPS6,RPS7,RPS8,UBA52

AXL+SIGLEC6+


SRP-dependent cotranslational

protein targeting to membranetop of list 0.00034

EEF1A1,EEF2,GNB2L1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL36AL,RPL37,RPL5,RPL7,RP

L9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,SEC11A,SEC11C,SPCS1,UBA52

AXL+SIGLEC6+

dendritic cell43 CL:14985 Viral mRNA Translation top of list 0.00073

RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL29,RPL35A,RPL7,RPL9,RPS12,RPS14,RPS15A,RPS2,RPS23,RPS3A,RPS4X,RPS6,RPS7,RPS8,UB

A52

AXL+SIGLEC6+





Cytolysis

bottom of

list0.0033 CD2,GNLY,GZMB,GZMH,HCST,HLA-A,HLA-C,HLA-E,KLRD1,NKG7

AXL+SIGLEC6+





Cytolysis

bottom of

list0.0052 GNLY,GZMB,GZMH,HCST,HLA-A,HLA-C,HLA-E,KLRD1,NKG7

Table S7 The differential expression of intereron related genes in each cell (sub)types of COVID-19 patients with normals

Disease

conditionSymbol pct.1 pct.2 case_Mean_UMI_Countscontrol_Mean_UMI_CountsLog2_Fold_ChangePvalue AdjustPvaluecluster Cell (sub)type

critical IFI27 0.548 0.005 5.677419355 0.009324009 2.72590127 5.53E-21 9.58E-17 22CD1C-CD141- dendritic cell

critical IFI27 0.203 0 0.7734375 0 0.826548487 6.62E-32 1.15E-27 15CD1C+_B dendritic cell

critical IFI27 0.344 0.007 2.323135755 0.021582734 1.701739184 2.66E-81 4.61E-77 8CD1C+_B dendritic cell

critical IFI44L 0.548 0.082 0.774193548 0.095571096 0.695480294 9.46E-11 1.64E-06 22CD1C-CD141- dendritic cell

critical IFI44L 0.75 0.043 0.75 0.108695652 0.658491536 0 0 37CD141+CLEC9A+ dendritic cell

critical IFI44L 0.75 0.043 0.75 0.108695652 0.658491536 0 0 46AXL+SIGLEC6+ dendritic cell

critical IFI6 0.806 0.378 2.193548387 0.545454545 1.047129087 6.48E-13 1.12E-08 22CD1C-CD141- dendritic cell

critical IFI6 0.73 0.347 1.627151052 0.594039054 0.720812176 4.70E-53 8.14E-49 8CD1C+_B dendritic cell

critical IFITM1 0.98 0.937 7.801980198 4.648737651 0.639899628 1.12E-10 1.94E-06 14CD8+ T cell


critical IFITM1 0.812 0.627 3.29296875 1.120165746 1.017798618 2.23E-53 3.87E-49 15CD1C+_B dendritic cell

critical IFITM2 1 0.974 16.5990566 5.662251656 1.40141634 5.45E-22 9.44E-18 25CD4+ cytotoxic T cell




critical IFITM3 1 0.887 9.594339623 2.562913907 1.572164135 1.89E-34 3.27E-30 25CD4+ cytotoxic T cell

critical IFITM3 1 0.869 8.8359375 3.42679558 1.151799813 5.85E-63 1.01E-58 15CD1C+_B dendritic cell


critical IFITM3 0.44 0.171 0.76 0.171428571 0.587306441 0 0 35CD8+ T cell

critical IFITM3 0.44 0.171 0.76 0.171428571 0.587306441 0 0 43B cell

critical IRF1 0.15 0.448 0.20501139 0.850198413 -0.618633209 1.44E-33 2.49E-29 9Effector CD8+ memory T (Tem) cell

critical IRF1 0.142 0.453 0.189054726 0.871004566 -0.653997963 1.08E-33 1.87E-29 10B cell

critical IRF1 0.297 0.695 0.609375 2.299723757 -1.035844724 1.73E-35 2.99E-31 15CD1C+_B dendritic cell

critical IRF1 0.392 0.731 0.663194444 2.056254136 -0.877807668 1.95E-38 3.37E-34 4CD8+ T cell

critical IRF1 0.491 0.767 0.885277247 2.1336074 -0.73304774 1.68E-44 2.91E-40 8CD1C+_B dendritic cell

critical IRF1 0.374 0.609 0.524193548 1.386014781 -0.646556867 7.54E-74 1.31E-69 3CD4+ T cell

critical IRF1 0.2 0.686 0.2 1.628571429 -1.131244533 0 0 35CD8+ T cell

critical IRF1 0.2 0.686 0.2 1.628571429 -1.131244533 0 0 43B cell

critical ISG20 0.633 0.19 1.081632653 0.329694323 0.646620868 2.91E-09 5.05E-05 20CD4+ T helper

critical ISG20 0.768 0.479 1.571428571 0.686419753 0.608606409 5.64E-10 9.78E-06 21CD4+ cytotoxic T cell

critical ISG20 0.844 0.428 1.84375 0.577264654 0.850369886 8.75E-14 1.52E-09 19CD141+CLEC9A+ dendritic cell

critical ISG20 0.814 0.601 2.064777328 1.038765823 0.588086185 1.47E-28 2.54E-24 7CD8+ T cell


critical ISG20 0.837 0.531 1.885416667 0.843812045 0.646088068 9.59E-44 1.66E-39 4CD8+ T cell


critical MT2A 0.461 0.373 1.984375 0.968232044 0.600528511 1.51E-11 2.61E-07 15CD1C+_B dendritic cell

critical MT2A 0.727 0.623 4.390057361 1.924974306 0.881876675 1.12E-30 1.95E-26 8CD1C+_B dendritic cell

critical SAMHD1 0.25 0.626 0.55859375 1.468232044 -0.663233096 4.42E-25 7.66E-21 15CD1C+_B dendritic cell

critical SAMHD1 0.721 0.889 1.223709369 2.354573484 -0.593161102 6.22E-51 1.08E-46 8CD1C+_B dendritic cell

severe ADAR 0.409 0.215 1.396923077 0.455823293 0.719348357 1.16E-23 2.05E-19 18CD4+ T helper

severe BST2 0.8 0.311 2.2 0.426229508 1.165865747 3.15E-10 5.56E-06 43Plasmacytoid dendritic cell

severe BST2 0.706 0.304 2.117647059 0.326086957 1.233282232 1.18E-11 2.07E-07 44CD8 cytoxict cells

severe BST2 0.6 0.176 1.177777778 0.215686275 0.841085779 7.33E-12 1.29E-07 32Naive CD8+ T cell

severe BST2 0.727 0.206 1.909090909 0.242990654 1.226752932 6.11E-12 1.08E-07 40CD8+ T cell


severe BST2 1 0.737 7.347826087 1.824561404 1.563373681 7.52E-15 1.33E-10 45Plasmacytoid dendritic cell

severe BST2 0.633 0.254 1.133333333 0.307692308 0.706086281 7.05E-19 1.24E-14 26 T cell


severe BST2 0.841 0.146 1.492753623 0.238095238 1.009618003 2.88E-27 5.08E-23 28CD1C+_B dendritic cell

severe BST2 0.971 0.667 4.507246377 1.209302326 1.317740298 1.75E-27 3.09E-23 35Effector CD8+ memory T (Tem) cell



severe BST2 0.758 0.413 1.552795031 0.564102564 0.706742587 6.14E-32 1.08E-27 19CD141+CLEC9A+ dendritic cell

severe BST2 0.93 0.248 1.91959799 0.460176991 0.999626481 7.73E-36 1.36E-31 30CD1C-CD141- dendritic cell

severe BST2 0.842 0.277 2.293233083 0.36416185 1.271489802 2.54E-37 4.48E-33 31CD8 cytoxict cells



severe BST2 0.844 0.288 2.052023121 0.392156863 1.132444114 1.91E-45 3.37E-41 24T cell(Activated T cell)

severe BST2 0.922 0.365 2.558823529 0.508108108 1.238660545 7.74E-47 1.37E-42 25Megakaryocyte progenitor cell









severe BST2 0.903 0.407 3 0.532804614 1.383826191 1.02E-109 1.80E-105 8Effector CD8+ memory T (Tem) cell





severe BST2 0.978 0.155 1.541538462 0.381526104 0.879439241 1.30E-148 2.29E-144 18CD4+ T helper

severe BST2 0.571 0.205 0.993109388 0.252766252 0.669903639 5.27E-168 9.30E-164 1Naive CD4+ T cell






severe DDX60 0.405 0.052 0.630057803 0.055555556 0.626920613 3.50E-25 6.18E-21 24T cell(Activated T cell)

severe DDX60 0.4 0.07 0.8 0.075376884 0.743154541 0 0 34CD8 cytoxict cells

severe EPSTI1 0.8 0.101 2 0.105527638 1.440227408 6.68E-11 1.18E-06 34CD8 cytoxict cells

severe EPSTI1 0.565 0.191 0.990740741 0.226086957 0.699244046 1.39E-11 2.46E-07 33Plasmacytoid dendritic cell

severe EPSTI1 0.556 0.059 0.866666667 0.078431373 0.791529955 1.92E-12 3.39E-08 32Naive CD8+ T cell

severe EPSTI1 0.743 0.096 1.257142857 0.168674699 0.94962432 2.01E-16 3.54E-12 38Plasmacytoid dendritic cell

severe EPSTI1 0.739 0.217 1.31884058 0.248062016 0.893714015 4.88E-18 8.61E-14 35Effector CD8+ memory T (Tem) cell

severe EPSTI1 0.589 0.122 1.035714286 0.138613861 0.838256524 2.01E-19 3.55E-15 29CD8+ T cell

severe EPSTI1 0.609 0.044 0.927536232 0.081632653 0.833547368 5.30E-24 9.35E-20 28CD1C+_B dendritic cell

severe EPSTI1 0.677 0.133 1.330827068 0.150289017 1.018845577 4.70E-29 8.30E-25 31CD8 cytoxict cells

severe EPSTI1 0.637 0.124 1.196078431 0.143243243 0.941797187 2.45E-30 4.33E-26 25Megakaryocyte progenitor cell


severe EPSTI1 0.588 0.084 0.925 0.090452261 0.819931834 1.91E-34 3.37E-30 20CD141+CLEC9A+ dendritic cell



severe EPSTI1 0.7 0.101 1.1 0.103550296 0.928236944 4.14E-43 7.30E-39 26 T cell

severe EPSTI1 0.814 0.053 2.055276382 0.07079646 1.512618618 2.72E-43 4.80E-39 30CD1C-CD141- dendritic cell


severe EPSTI1 0.809 0.265 2.427745665 0.362745098 1.330744336 1.40E-48 2.48E-44 24T cell(Activated T cell)






severe EPSTI1 0.923 0.304 2.602564103 0.409190372 1.354157578 4.20E-74 7.41E-70 21CD1C-CD141- dendritic cell




severe EPSTI1 0.812 0.052 1.295384615 0.102409639 1.058075505 1.43E-121 2.52E-117 18CD4+ T helper








severe EPSTI1 0.473 0.08 0.690783807 0.084024896 0.64129431 1.99E-226 3.51E-222 1Naive CD4+ T cell

severe EPSTI1 0.545 0.112 0.727272727 0.112149533 0.635145118 0 0 40CD8+ T cell

severe EPSTI1 0.542 0.024 0.916666667 0.024096386 0.904247951 0 0 42Megakaryocyte progenitor cell

severe EPSTI1 0.522 0.105 0.695652174 0.105263158 0.617450353 0 0 45Plasmacytoid dendritic cell

severe EPSTI1 0.645 0.211 0.870967742 0.210526316 0.628150242 0 0 46B cell

severe FCGR1A 0.598 0.157 0.946619217 0.220915033 0.6730079 1.45E-42 2.56E-38 15CD1C+_B dendritic cell

severe FCGR1A 0.686 0.098 1.256410256 0.111597374 1.021395068 2.50E-51 4.42E-47 21CD1C-CD141- dendritic cell

severe FCGR1A 0.852 0.361 1.744 0.426535088 0.943765249 1.25E-145 2.20E-141 9CD1C+_B dendritic cell

severe GBP1 0.459 0.127 0.879699248 0.161849711 0.694078386 6.79E-12 1.20E-07 31CD8 cytoxict cells

severe GBP1 0.647 0.268 1.312138728 0.408496732 0.715071746 4.32E-17 7.63E-13 24T cell(Activated T cell)

severe GBP1 0.5 0.16 0.8125 0.183544304 0.614867283 1.83E-21 3.23E-17 22CD8+ T cell

severe GBP1 0.563 0.171 0.970873786 0.205479452 0.70922833 8.98E-31 1.58E-26 8Effector CD8+ memory T (Tem) cell

severe GBP1 0.788 0.319 1.948717949 0.371991247 1.103816554 3.54E-68 6.24E-64 21CD1C-CD141- dendritic cell

severe GBP1 0.58 0.166 0.992 0.198464912 0.733029976 7.76E-72 1.37E-67 9CD1C+_B dendritic cell



severe GBP1 0.4 0.068 1.2 0.068181818 1.042346291 0 0 47AXL+SIGLEC6+ dendritic cell

severe GBP2 0.4 0.261 1.8 0.286432161 1.122051448 3.97E-13 7.00E-09 34CD8 cytoxict cells

severe GBP2 0.4 0.114 0.8 0.113636364 0.692718681 0 0 47AXL+SIGLEC6+ dendritic cell

severe IFI27 0.5 0 1.25 0 1.169925001 4.34E-09 7.66E-05 42Megakaryocyte progenitor cell

severe IFI27 0.278 0.009 3.574074074 0.008695652 2.180988785 1.87E-09 3.30E-05 33Plasmacytoid dendritic cell

severe IFI27 0.652 0 11.13043478 0 3.600559356 2.73E-10 4.82E-06 45Plasmacytoid dendritic cell

severe IFI27 0.321 0.003 1.571428571 0.00330033 1.357816549 4.24E-14 7.49E-10 29CD8+ T cell

severe IFI27 1 0.008 41.09090909 0.016666667 5.371590023 8.86E-18 1.56E-13 39CD141+CLEC9A+ dendritic cell

severe IFI27 0.391 0.006 1.541353383 0.005780347 1.337281733 9.61E-20 1.70E-15 31CD8 cytoxict cells



severe IFI27 0.388 0.005 0.95 0.016750419 0.939508539 5.14E-27 9.07E-23 20CD141+CLEC9A+ dendritic cell

severe IFI27 0.609 0.007 1.971014493 0.010204082 1.556308867 2.68E-33 4.72E-29 28CD1C+_B dendritic cell

severe IFI27 0.292 0 0.590062112 0 0.669083122 9.46E-35 1.67E-30 19CD141+CLEC9A+ dendritic cell

severe IFI27 0.375 0 1.3125 0 1.209453366 1.20E-35 2.12E-31 22CD8+ T cell

severe IFI27 0.445 0.003 4.554913295 0.006535948 2.464365695 1.00E-37 1.77E-33 24T cell(Activated T cell)


severe IFI27 0.706 0.005 1.941176471 0.010810811 1.540880349 1.98E-56 3.49E-52 25Megakaryocyte progenitor cell

severe IFI27 0.376 0 0.881443299 0 0.911839812 1.39E-59 2.46E-55 16CD8+ T cell

severe IFI27 0.945 0 4.391959799 0 2.43080974 3.89E-72 6.87E-68 30CD1C-CD141- dendritic cell



severe IFI27 0.927 0 3.759776536 0 2.250893843 7.91E-91 1.40E-86 27Megakaryocyte progenitor cell


severe IFI27 0.329 0 0.846889952 0 0.885097905 1.59E-113 2.81E-109 5Effector CD8+ memory T (Tem) cell

severe IFI27 0.929 0.004 46.35897436 0.008752735 5.552993347 1.13E-128 2.00E-124 21CD1C-CD141- dendritic cell


severe IFI27 0.416 0.003 1.420273349 0.004178273 1.269154581 3.29E-170 5.81E-166 3Effector CD8+ memory T (Tem) cell

severe IFI27 0.883 0 1.643076923 0 1.402218413 1.42E-179 2.51E-175 18CD4+ T helper


severe IFI27 1 0.006 11.06 0.015889831 3.569414046 3.41E-221 6.02E-217 14Megakaryocyte progenitor cell

severe IFI27 0.329 0.001 0.769652651 0.00122549 0.821699288 0 0 4Effector CD8+ memory T (Tem) cell


severe IFI27 0.982 0.007 55.002 0.020833333 5.777659103 0 0 9CD1C+_B dendritic cell

severe IFI27 0.355 0.006 1.151436031 0.005580357 1.097271572 0 0 11CD4+ T cell

severe IFI27 0.533 0.033 8.977777778 0.032786885 3.272175952 0 0 43Plasmacytoid dendritic cell



severe IFI35 0.667 0.225 1 0.255813953 0.671377253 1.08E-11 1.90E-07 35Effector CD8+ memory T (Tem) cell


















severe IFI35 0.529 0.174 0.852941176 0.173913043 0.658491536 0 0 44CD8 cytoxict cells

severe IFI44 0.352 0.035 1 0.079646018 0.889441625 7.47E-11 1.32E-06 30CD1C-CD141- dendritic cell














severe IFI44 0.457 0.067 0.742857143 0.066666667 0.708344916 0 0 41Naive CD8+ T cell

severe IFI44 0.542 0.036 0.75 0.036144578 0.756129599 0 0 42Megakaryocyte progenitor cell

severe IFI44 0.4 0.136 0.8 0.136363636 0.663572335 0 0 47AXL+SIGLEC6+ dendritic cell

severe IFI44L 1 0 3.4 0 2.137503524 3.55E-10 6.26E-06 34CD8 cytoxict cells

severe IFI44L 0.909 0.075 2.363636364 0.083333333 1.63454453 3.60E-12 6.35E-08 39CD141+CLEC9A+ dendritic cell

severe IFI44L 0.935 0.079 3.612903226 0.157894737 1.994170921 1.56E-13 2.75E-09 46B cell

severe IFI44L 0.957 0.123 3.565217391 0.175438596 1.957484385 2.04E-17 3.59E-13 45Plasmacytoid dendritic cell

severe IFI44L 0.8 0.011 2.742857143 0.011111111 1.888198441 1.06E-19 1.87E-15 41Naive CD8+ T cell

severe IFI44L 0.958 0.012 3.041666667 0.036144578 1.963725018 5.43E-20 9.58E-16 42Megakaryocyte progenitor cell

severe IFI44L 0.909 0 2.681818182 0 1.880418384 4.43E-21 7.82E-17 40CD8+ T cell

severe IFI44L 0.973 0.033 3.189189189 0.046052632 2.001715598 1.03E-32 1.82E-28 36CD8+ T cell


severe IFI44L 0.933 0.044 3.711111111 0.058823529 2.153605198 4.17E-39 7.36E-35 32Naive CD8+ T cell

severe IFI44L 1 0.036 3.757142857 0.072289157 2.149401351 1.16E-40 2.05E-36 38Plasmacytoid dendritic cell

severe IFI44L 0.737 0.017 2.165413534 0.028901734 1.621288784 1.61E-44 2.84E-40 31CD8 cytoxict cells

severe IFI44L 0.971 0.047 3.637681159 0.062015504 2.126598811 7.43E-45 1.31E-40 35Effector CD8+ memory T (Tem) cell


severe IFI44L 0.928 0.003 2.47826087 0.003401361 1.793467339 6.73E-63 1.19E-58 28CD1C+_B dendritic cell

severe IFI44L 0.99 0.08 4.301507538 0.168141593 2.182187506 2.22E-69 3.92E-65 30CD1C-CD141- dendritic cell

severe IFI44L 0.911 0.024 3.1 0.026627219 1.997711493 2.73E-74 4.82E-70 26 T cell

severe IFI44L 0.814 0.079 1.923076923 0.09190372 1.420642145 1.44E-80 2.54E-76 21CD1C-CD141- dendritic cell

severe IFI44L 0.879 0.059 3 0.078431373 1.891065628 8.70E-85 1.53E-80 24T cell(Activated T cell)


severe IFI44L 0.939 0 1.262569832 0 1.177962321 2.69E-93 4.74E-89 27Megakaryocyte progenitor cell









severe IFI44L 0.997 0.01 3.713846154 0.024096386 2.202553169 5.73E-227 1.01E-222 18CD4+ T helper






severe IFI44L 0.888 0.025 2.740740741 0.030428769 1.860079202 0 0 1Naive CD4+ T cell

severe IFI44L 0.92 0.042 3.273822563 0.05308311 2.020907713 0 0 2CD4+ T cell

severe IFI44L 0.839 0.016 2.438596491 0.021641791 1.750930384 0 0 5Effector CD8+ memory T (Tem) cell





severe IFI44L 0.556 0.026 1.157407407 0.026086957 1.072145644 0 0 33Plasmacytoid dendritic cell


severe IFI44L 0.853 0.043 2.470588235 0.043478261 1.733779663 0 0 44CD8 cytoxict cells




severe IFI6 0.771 0.156 2.028571429 0.166666667 1.376245016 9.93E-18 1.75E-13 41Naive CD8+ T cell

severe IFI6 1 0.156 3.6 0.165829146 1.980277487 8.68E-19 1.53E-14 34CD8 cytoxict cells



severe IFI6 0.778 0.191 2.444444444 0.215686275 1.502500341 6.37E-31 1.12E-26 32Naive CD8+ T cell



severe IFI6 0.756 0.13 2.044444444 0.144970414 1.410868667 1.30E-49 2.30E-45 26 T cell










severe IFI6 1 0.044 3.190954774 0.07079646 1.968594678 1.12E-79 1.98E-75 30CD1C-CD141- dendritic cell











severe IFI6 0.997 0.05 2.135384615 0.088353414 1.526495319 2.99E-202 5.27E-198 18CD4+ T helper

severe IFI6 1 0.016 4.07 0.050847458 2.270432486 1.82E-206 3.21E-202 14Megakaryocyte progenitor cell




severe IFI6 0.795 0.15 1.931955211 0.162863071 1.334181838 0 0 1Naive CD4+ T cell





severe IFI6 0.994 0.363 8.756 0.625 2.58585004 0 0 9CD1C+_B dendritic cell

severe IFI6 0.667 0.145 1.75 0.144578313 1.264615442 0 0 42Megakaryocyte progenitor cell

severe IFIT1 0.389 0.009 0.694444444 0.008695652 0.748321392 3.08E-13 5.44E-09 33Plasmacytoid dendritic cell

severe IFIT1 0.375 0 0.714285714 0 0.777607579 1.68E-18 2.97E-14 29CD8+ T cell

severe IFIT1 0.459 0.012 0.751879699 0.028901734 0.767798506 3.33E-23 5.88E-19 31CD8 cytoxict cells

severe IFIT1 0.379 0.016 0.633540373 0.02724359 0.669223783 8.75E-35 1.54E-30 19CD141+CLEC9A+ dendritic cell

severe IFIT1 0.359 0.006 0.59223301 0.007930786 0.659654904 2.17E-37 3.83E-33 8Effector CD8+ memory T (Tem) cell

severe IFIT1 0.539 0.003 0.843137255 0.002702703 0.878269594 2.45E-40 4.32E-36 25Megakaryocyte progenitor cell

severe IFIT1 0.555 0.02 1.231213873 0.035947712 1.106877622 3.65E-43 6.44E-39 24T cell(Activated T cell)

severe IFIT1 0.571 0.059 1.153846154 0.067833698 1.012228221 3.44E-44 6.06E-40 21CD1C-CD141- dendritic cell

severe IFIT1 0.38 0.007 0.631683168 0.00811124 0.694706108 3.35E-85 5.90E-81 10CD8+ T cell




severe IFIT1 0.454 0.004 0.729381443 0.004081633 0.784379548 0 0 16CD8+ T cell



severe IFIT2 0.448 0.111 0.84 0.175438596 0.64650659 9.82E-44 1.73E-39 9CD1C+_B dendritic cell

severe IFIT3 0.677 0 1.516129032 0 1.331205908 6.21E-10 1.10E-05 46B cell


severe IFIT3 0.429 0.012 0.828571429 0.012048193 0.853438992 4.46E-10 7.87E-06 38Plasmacytoid dendritic cell

severe IFIT3 0.405 0 0.513513514 0 0.597901556 7.49E-12 1.32E-07 36CD8+ T cell

severe IFIT3 0.657 0.011 1 0.011111111 0.984058456 7.79E-14 1.37E-09 41Naive CD8+ T cell

severe IFIT3 0.489 0.005 0.822222222 0.004901961 0.858644151 1.64E-16 2.89E-12 32Naive CD8+ T cell

severe IFIT3 0.406 0.023 0.766917293 0.040462428 0.764009642 3.75E-17 6.62E-13 31CD8 cytoxict cells

severe IFIT3 0.467 0 0.788944724 0 0.83910881 1.22E-22 2.16E-18 30CD1C-CD141- dendritic cell




severe IFIT3 0.578 0.015 1.211111111 0.023668639 1.111022733 5.58E-35 9.85E-31 26 T cell

severe IFIT3 0.536 0 0.793296089 0 0.84261371 1.58E-38 2.79E-34 27Megakaryocyte progenitor cell


severe IFIT3 0.728 0.036 2.219653179 0.068627451 1.591146307 1.14E-60 2.02E-56 24T cell(Activated T cell)



severe IFIT3 0.52 0.01 0.796923077 0.016064257 0.822537008 2.16E-74 3.81E-70 18CD4+ T helper














severe IFIT3 0.532 0.01 0.958656331 0.011065007 0.953988523 0 0 1Naive CD4+ T cell

severe IFIT3 0.566 0.01 1.12195122 0.010348071 1.070539095 0 0 12Megakaryocyte progenitor cell




severe IFIT3 0.296 0.035 0.787037037 0.034782609 0.788241823 0 0 33Plasmacytoid dendritic cell

severe IFIT3 0.4 0.01 1 0.010050251 0.985572929 0 0 34CD8 cytoxict cells

severe IFITM1 1 0.183 10.18181818 0.491666667 2.906157705 2.83E-11 4.99E-07 39CD141+CLEC9A+ dendritic cell

severe IFITM1 0.968 0.237 11.29032258 0.368421053 3.166938672 5.75E-19 1.02E-14 46B cell

severe IFITM1 1 0.952 19.54166667 4.277108434 1.960733707 4.63E-21 8.17E-17 42Megakaryocyte progenitor cell

severe IFITM1 1 0.891 23.17647059 4 2.273603648 6.98E-23 1.23E-18 44CD8 cytoxict cells

severe IFITM1 0.933 0.262 14.02222222 0.524590164 3.300604866 4.68E-24 8.25E-20 43Plasmacytoid dendritic cell

severe IFITM1 1 1 18.8 4.488888889 1.85091439 1.15E-27 2.02E-23 41Naive CD8+ T cell

severe IFITM1 1 0.963 22.27272727 4.252336449 2.147609048 9.39E-30 1.66E-25 40CD8+ T cell



severe IFITM1 1 0.626 25.75925926 5.643478261 2.010027498 6.26E-35 1.10E-30 33Plasmacytoid dendritic cell

severe IFITM1 1 1 33.1884058 12.34883721 1.356793074 6.62E-37 1.17E-32 35Effector CD8+ memory T (Tem) cell


severe IFITM1 1 1 19.91111111 5.573529412 1.669529636 9.13E-39 1.61E-34 32Naive CD8+ T cell

severe IFITM1 1 0.986 21.89855072 5.707482993 1.771412895 1.84E-40 3.24E-36 28CD1C+_B dendritic cell

severe IFITM1 1 1 31.28571429 8.858085809 1.711516502 1.05E-56 1.85E-52 29CD8+ T cell

severe IFITM1 0.995 0.92 7.27638191 1.663716814 1.635559505 5.64E-58 9.94E-54 30CD1C-CD141- dendritic cell

severe IFITM1 1 1 8.603076923 4.202811245 0.884205366 4.23E-68 7.47E-64 18CD4+ T helper

severe IFITM1 0.972 0.913 5.972067039 1.605128205 1.420232069 4.12E-74 7.28E-70 27Megakaryocyte progenitor cell


severe IFITM1 1 0.967 22.25555556 5.269230769 1.891215064 4.19E-78 7.40E-74 26 T cell

severe IFITM1 1 0.954 28.0075188 6.167630058 2.016858815 7.65E-81 1.35E-76 31CD8 cytoxict cells

severe IFITM1 1 0.931 28.17919075 7.232026144 1.825620403 1.01E-91 1.79E-87 24T cell(Activated T cell)



severe IFITM1 1 0.993 26.68932039 7.06777217 1.779087396 7.87E-121 1.39E-116 8Effector CD8+ memory T (Tem) cell



severe IFITM1 1 0.4 24.34615385 1.098468271 3.594358287 1.92E-182 3.39E-178 21CD1C-CD141- dendritic cell






severe IFITM1 1 0.993 8.91 2.11440678 1.6699276674.89960684377016e-312 8.65E-308 14Megakaryocyte progenitor cell

severe IFITM1 1 0.971 18.98621878 5.031811895 1.728342209 0 0 1Naive CD4+ T cell

severe IFITM1 1 0.981 23.00876232 5.726541555 1.835624193 0 0 2CD4+ T cell

severe IFITM1 1 0.997 29.75854214 7.701253482 1.821691973 0 0 3Effector CD8+ memory T (Tem) cell





severe IFITM1 0.996 0.093 15.142 0.222587719 3.722809454 0 0 9CD1C+_B dendritic cell


severe IFITM1 1 0.394 12.60273973 0.602771363 3.085256711 0 0 13CD141+CLEC9A+ dendritic cell

severe IFITM2 0.903 0.342 3.258064516 0.526315789 1.480144327 6.69E-10 1.18E-05 46B cell





severe IFITM2 0.9 0.642 2.577777778 1.198224852 0.702724818 1.00E-14 1.77E-10 26 T cell

severe IFITM2 0.925 0.745 3.630057803 1.895424837 0.677255159 2.47E-15 4.36E-11 24T cell(Activated T cell)

severe IFITM2 0.955 0.815 6.07518797 2.479768786 1.023777028 1.28E-21 2.26E-17 31CD8 cytoxict cells

severe IFITM2 0.878 0.634 2.941489362 1.318309859 0.765667475 1.07E-22 1.88E-18 23CD4+ T cell

severe IFITM2 0.99 0.901 6.766990291 3.271809661 0.862508296 2.84E-27 5.01E-23 8Effector CD8+ memory T (Tem) cell


severe IFITM2 0.938 0.704 4.65 1.475711893 1.190407435 2.50E-35 4.41E-31 20CD141+CLEC9A+ dendritic cell














severe IFITM2 0.885 0.637 2.529715762 1.170816044 0.701314536 3.14E-150 5.54E-146 1Naive CD4+ T cell

severe IFITM2 0.996 0.723 7.072 1.797149123 1.528969005 1.47E-233 2.59E-229 9CD1C+_B dendritic cell

severe IFITM3 1 0.432 10 0.636363636 2.748938236 5.78E-10 1.02E-05 47AXL+SIGLEC6+ dendritic cell









severe IFITM3 0.928 0.639 5.52173913 1.568027211 1.344596245 2.06E-19 3.63E-15 28CD1C+_B dendritic cell


severe IFITM3 1 0.953 13.33333333 5.348837209 1.174809868 2.25E-26 3.98E-22 35Effector CD8+ memory T (Tem) cell

severe IFITM3 0.878 0.491 2.3 0.730769231 0.931052646 1.43E-26 2.52E-22 26 T cell


severe IFITM3 1 0.761 8.105527638 1.946902655 1.627543215 1.24E-33 2.18E-29 30CD1C-CD141- dendritic cell

severe IFITM3 0.947 0.566 4.278195489 1.092485549 1.334827125 3.92E-34 6.92E-30 31CD8 cytoxict cells

severe IFITM3 0.896 0.546 3.479768786 1.062091503 1.11931592 1.70E-35 3.00E-31 24T cell(Activated T cell)













severe IFITM3 1 1 56.74358974 17.65207877 1.63032437 1.59E-125 2.80E-121 21CD1C-CD141- dendritic cell



severe IFITM3 1 0.775 4.323076923 1.086345382 1.351282408 1.30E-141 2.29E-137 18CD4+ T helper





severe IFITM3 0.871 0.48 2.54005168 0.719571231 1.041721543 0 0 1Naive CD4+ T cell

severe IFITM3 1 0.923 47.392 4.742324561 3.075061785 0 0 9CD1C+_B dendritic cell

severe IFITM3 1 0.888 13.77 1.134533898 2.790676847 0 0 14Megakaryocyte progenitor cell

severe IFITM3 1 0.872 40.97153025 3.341176471 3.273253089 0 0 15CD1C+_B dendritic cell

severe IFITM3 0.935 0.211 2.935483871 0.210526316 1.700906585 0 0 46B cell

severe IRF1 0.594 0.806 0.811594203 2.279069767 -0.85602677 8.16E-12 1.44E-07 35Effector CD8+ memory T (Tem) cell

severe IRF2 0.363 0.138 1.061452514 0.235897436 0.738102206 4.75E-11 8.38E-07 27Megakaryocyte progenitor cell

severe IRF2BP2 0.532 0.212 0.878205128 0.242888403 0.595657871 3.63E-25 6.41E-21 21CD1C-CD141- dendritic cell

severe IRF7 0.909 0.308 2.818181818 0.4 1.447458977 2.11E-09 3.72E-05 39CD141+CLEC9A+ dendritic cell

severe IRF7 0.871 0.211 2.129032258 0.236842105 1.339055194 1.04E-10 1.84E-06 46B cell

severe IRF7 0.676 0.105 1 0.118421053 0.838536577 1.60E-12 2.83E-08 36CD8+ T cell

severe IRF7 0.818 0.14 1.409090909 0.14953271 1.067441317 2.69E-13 4.75E-09 40CD8+ T cell

severe IRF7 0.62 0.191 1.314814815 0.226086957 0.916835481 3.63E-16 6.41E-12 33Plasmacytoid dendritic cell


severe IRF7 0.929 0.169 2.142857143 0.397590361 1.169135133 1.80E-22 3.17E-18 38Plasmacytoid dendritic cell

severe IRF7 0.826 0.202 1.869565217 0.240310078 1.210131324 1.51E-22 2.66E-18 35Effector CD8+ memory T (Tem) cell

severe IRF7 0.822 0.118 1.666666667 0.137254902 1.229481846 3.88E-25 6.85E-21 32Naive CD8+ T cell


severe IRF7 0.633 0.095 1.322222222 0.103550296 1.073353652 4.54E-34 8.02E-30 26 T cell

severe IRF7 0.797 0.065 1.231884058 0.085034014 1.040521815 9.12E-35 1.61E-30 28CD1C+_B dendritic cell

severe IRF7 0.889 0.115 1.668341709 0.212389381 1.13809031 1.66E-43 2.93E-39 30CD1C-CD141- dendritic cell


severe IRF7 0.797 0.081 1.533834586 0.086705202 1.221361722 1.01E-44 1.79E-40 31CD8 cytoxict cells

severe IRF7 0.809 0.167 1.832369942 0.209150327 1.228016094 2.53E-54 4.47E-50 24T cell(Activated T cell)



severe IRF7 0.923 0.44 2.974358974 0.606126915 1.307136289 1.57E-72 2.78E-68 21CD1C-CD141- dendritic cell












severe IRF7 0.963 0.054 1.790769231 0.106425703 1.334756256 1.36E-179 2.40E-175 18CD4+ T helper








severe IRF7 0.722 0.089 1.465977606 0.097510373 1.167925122 0 0 1Naive CD4+ T cell

severe IRF7 0.713 0.096 1.271276596 0.095774648 1.051552277 0 0 23CD4+ T cell

severe IRF7 0.743 0.111 1.285714286 0.111111111 1.040641984 0 0 41Naive CD8+ T cell

severe IRF7 0.417 0.084 0.666666667 0.084337349 0.620151929 0 0 42Megakaryocyte progenitor cell

severe IRF7 0.8 0.091 1.6 0.090909091 1.252980741 0 0 47AXL+SIGLEC6+ dendritic cell

severe ISG15 1 0.167 2.545454545 0.208333333 1.552952106 3.83E-11 6.76E-07 39CD141+CLEC9A+ dendritic cell

severe ISG15 0.8 0.266 5.2 0.35678392 2.192077239 2.63E-11 4.65E-07 34CD8 cytoxict cells

severe ISG15 0.792 0.12 2.375 0.144578313 1.560071325 8.94E-13 1.58E-08 42Megakaryocyte progenitor cell


severe ISG15 0.857 0.111 2.342857143 0.133333333 1.560509457 3.57E-18 6.30E-14 41Naive CD8+ T cell

severe ISG15 0.978 0.328 6.2 0.606557377 2.1640244 1.88E-18 3.31E-14 43Plasmacytoid dendritic cell

severe ISG15 0.811 0.1 1.972972973 0.114285714 1.415787146 6.36E-20 1.12E-15 37CD8+ T cell


severe ISG15 0.913 0.302 3.739130435 0.465116279 1.6936072 4.00E-27 7.05E-23 35Effector CD8+ memory T (Tem) cell




severe ISG15 0.971 0.068 3.507246377 0.095238095 2.04100178 9.86E-59 1.74E-54 28CD1C+_B dendritic cell

severe ISG15 0.822 0.133 2.7 0.147928994 1.688491865 3.67E-60 6.48E-56 26 T cell


severe ISG15 0.995 0.071 3.422110553 0.150442478 1.942546242 1.14E-72 2.01E-68 30CD1C-CD141- dendritic cell


severe ISG15 0.925 0.184 3.2875 0.22278057 1.809971139 3.09E-79 5.45E-75 20CD141+CLEC9A+ dendritic cell





severe ISG15 0.988 0.356 7.658959538 0.565359477 2.467699678 2.30E-104 4.06E-100 24T cell(Activated T cell)



severe ISG15 0.877 0.13 3 0.145901639 1.803516787 2.93E-138 5.16E-134 17CD4+ T cell






severe ISG15 0.997 0.04 2.609230769 0.064257028 1.761844773 1.03E-206 1.81E-202 18CD4+ T helper


severe ISG15 1 0.004 2.57 0.01059322 1.820721668 8.96E-222 1.58E-217 14Megakaryocyte progenitor cell




severe ISG15 0.825 0.107 2.277347115 0.116182573 1.553955455 0 0 1Naive CD4+ T cell

severe ISG15 0.897 0.15 3.43483023 0.177479893 1.913176454 0 0 2CD4+ T cell

severe ISG15 0.967 0.228 4.87357631 0.268802228 2.210771991 0 0 3Effector CD8+ memory T (Tem) cell





severe ISG15 0.913 0.035 3 0.035087719 1.950246965 0 0 45Plasmacytoid dendritic cell

severe ISG15 0.871 0.053 2.967741935 0.052631579 1.914317614 0 0 46B cell

severe ISG15 1 0.136 6 0.136363636 2.622930351 0 0 47AXL+SIGLEC6+ dendritic cell

severe ISG20 1 0.432 3.8 0.577889447 1.605038277 3.41E-09 6.02E-05 34CD8 cytoxict cells






severe ISG20 0.986 0.289 2 0.56626506 0.937634119 2.36E-21 4.17E-17 38Plasmacytoid dendritic cell



severe ISG20 0.811 0.459 2 0.624260355 0.885179598 6.72E-27 1.19E-22 26 T cell








severe ISG20 0.977 0.683 5.248554913 1.349673203 1.411062462 5.88E-60 1.04E-55 24T cell(Activated T cell)












severe ISG20 0.994 0.191 1.566153846 0.337349398 0.940231231 3.15E-141 5.55E-137 18CD4+ T helper








severe ISG20 0.545 0.058 1.454545455 0.058333333 1.213661792 0 0 39CD141+CLEC9A+ dendritic cell

severe ISG20 0.826 0.193 1.913043478 0.192982456 1.287954407 0 0 45Plasmacytoid dendritic cell

severe MT2A 0.8 0.25 6 0.272727273 2.459431619 5.48E-09 9.67E-05 47AXL+SIGLEC6+ dendritic cell

severe MT2A 0.686 0.2 2.057142857 0.244444444 1.296682144 2.89E-12 5.10E-08 41Naive CD8+ T cell

severe MT2A 0.909 0.28 2.227272727 0.373831776 1.232110142 7.98E-13 1.41E-08 40CD8+ T cell


severe MT2A 0.902 0.561 4.187969925 1.716763006 0.933281397 6.64E-16 1.17E-11 31CD8 cytoxict cells


severe MT2A 0.744 0.293 2.111111111 0.461538462 1.089942125 4.70E-21 8.29E-17 26 T cell


severe MT2A 0.453 0.138 0.782608696 0.166666667 0.611597627 1.08E-25 1.90E-21 19CD141+CLEC9A+ dendritic cell

severe MT2A 0.855 0.238 3.507246377 0.56122449 1.529568315 6.63E-26 1.17E-21 28CD1C+_B dendritic cell


severe MT2A 0.9 0.012 1.157142857 0.012048193 1.091843731 4.46E-32 7.88E-28 38Plasmacytoid dendritic cell



severe MT2A 0.902 0.535 4.343137255 0.937837838 1.46323923 1.38E-42 2.43E-38 25Megakaryocyte progenitor cell

severe MT2A 0.981 0.751 10.25 3.284463895 1.392738402 2.97E-43 5.25E-39 21CD1C-CD141- dendritic cell

severe MT2A 0.925 0.529 5.005780347 1.124183007 1.499443646 7.57E-44 1.34E-39 24T cell(Activated T cell)

severe MT2A 0.95 0.142 1.763819095 0.274336283 1.116917149 3.05E-50 5.38E-46 30CD1C-CD141- dendritic cell

severe MT2A 0.893 0.518 4.339805825 1.028839221 1.39613274 1.52E-54 2.68E-50 8Effector CD8+ memory T (Tem) cell












severe MT2A 0.991 0.106 1.723076923 0.263052209 1.108323462 1.93E-169 3.40E-165 18CD4+ T helper





severe MX1 0.75 0.133 1.875 0.168674699 1.298688545 3.08E-09 5.44E-05 42Megakaryocyte progenitor cell

severe MX1 1 0.509 4.217391304 1.01754386 1.370728603 1.34E-09 2.37E-05 45Plasmacytoid dendritic cell

severe MX1 1 0.208 3.909090909 0.391666667 1.818642187 5.03E-10 8.87E-06 39CD141+CLEC9A+ dendritic cell

severe MX1 0.968 0.132 2.548387097 0.157894737 1.615659298 1.14E-14 2.02E-10 46B cell

severe MX1 0.757 0.125 1.567567568 0.144736842 1.16538626 2.01E-17 3.55E-13 36CD8+ T cell

severe MX1 0.971 0.109 3.529411765 0.130434783 2.002445937 5.03E-18 8.88E-14 44CD8 cytoxict cells

severe MX1 1 0.084 2.454545455 0.093457944 1.659598162 1.52E-21 2.68E-17 40CD8+ T cell

severe MX1 0.986 0.205 3.157142857 0.554216867 1.419404502 2.50E-26 4.42E-22 38Plasmacytoid dendritic cell

severe MX1 0.911 0.088 2.733333333 0.117647059 1.739999654 1.01E-30 1.78E-26 32Naive CD8+ T cell

severe MX1 0.899 0.101 2.637681159 0.131782946 1.684421794 1.27E-33 2.23E-29 35Effector CD8+ memory T (Tem) cell

severe MX1 0.907 0.157 3.638888889 0.234782609 1.909522222 2.06E-36 3.63E-32 33Plasmacytoid dendritic cell


severe MX1 0.971 0.048 2.637681159 0.071428571 1.763483424 1.89E-57 3.34E-53 28CD1C+_B dendritic cell

severe MX1 0.844 0.115 2.744444444 0.133136095 1.724430539 5.63E-59 9.93E-55 26 T cell

severe MX1 0.838 0.077 2.2875 0.092127303 1.589849861 6.74E-62 1.19E-57 20CD141+CLEC9A+ dendritic cell

severe MX1 1 0.062 3.376884422 0.123893805 1.961398564 2.67E-76 4.71E-72 30CD1C-CD141- dendritic cell

severe MX1 0.954 0.206 5.092485549 0.352941176 2.170931809 1.42E-84 2.50E-80 24T cell(Activated T cell)




severe MX1 0.962 0.204 4.301282051 0.332603939 1.992093237 6.29E-93 1.11E-88 21CD1C-CD141- dendritic cell









severe MX1 0.997 0.062 3.313846154 0.138554217 1.921771733 1.99E-194 3.50E-190 18CD4+ T helper





severe MX1 0.842 0.098 2.300602929 0.113070539 1.568184564 0 0 1Naive CD4+ T cell

severe MX1 0.903 0.117 2.9550931 0.136193029 1.799503698 0 0 2CD4+ T cell

severe MX1 0.917 0.036 2.822323462 0.04178273 1.875395445 0 0 3Effector CD8+ memory T (Tem) cell




severe MX1 0.902 0.035 2.931372549 0.035135135 1.925213963 0 0 25Megakaryocyte progenitor cell

severe MX1 0.895 0.035 3.210526316 0.034682081 2.024813032 0 0 31CD8 cytoxict cells


severe MX1 0.857 0.122 2.228571429 0.122222222 1.524537559 0 0 41Naive CD8+ T cell




severe MX2 0.237 0.054 0.661538462 0.098393574 0.597124598 4.58E-19 8.08E-15 18CD4+ T helper




severe MX2 0.659 0.134 1.179190751 0.156862745 0.913574778 3.44E-38 6.06E-34 24T cell(Activated T cell)
















severe MX2 0.499 0.098 0.738156761 0.109266943 0.647951613 1.25E-200 2.21E-196 1Naive CD4+ T cell


severe MX2 0.556 0.127 0.844444444 0.127218935 0.710418584 0 0 26 T cell



severe MX2 0.419 0.053 0.580645161 0.052631579 0.586512952 0 0 46B cell

severe OAS1 0.429 0 0.742857143 0 0.801454321 1.56E-09 2.76E-05 41Naive CD8+ T cell

severe OAS1 0.432 0.014 0.567567568 0.021428571 0.61793931 1.07E-09 1.89E-05 37CD8+ T cell

severe OAS1 0.667 0 1.166666667 0 1.115477217 6.71E-13 1.18E-08 42Megakaryocyte progenitor cell

severe OAS1 0.757 0.12 1.057142857 0.240963855 0.729180889 5.92E-16 1.04E-11 38Plasmacytoid dendritic cell

severe OAS1 0.71 0.07 1.275362319 0.07751938 1.078382475 2.08E-22 3.66E-18 35Effector CD8+ memory T (Tem) cell

severe OAS1 0.668 0.097 0.929648241 0.14159292 0.757289587 7.30E-23 1.29E-18 30CD1C-CD141- dendritic cell

severe OAS1 0.633 0.03 1.177777778 0.035502959 1.072525072 1.05E-36 1.85E-32 26 T cell

severe OAS1 0.727 0.221 1.50310559 0.315705128 0.927882957 1.02E-38 1.80E-34 19CD141+CLEC9A+ dendritic cell


severe OAS1 0.681 0.003 1.014492754 0.010204082 0.99576984 1.06E-39 1.87E-35 28CD1C+_B dendritic cell

severe OAS1 0.704 0.005 0.720670391 0.005128205 0.775591233 1.32E-52 2.32E-48 27Megakaryocyte progenitor cell



severe OAS1 0.867 0.101 2.791907514 0.12745098 1.749859068 2.51E-76 4.44E-72 24T cell(Activated T cell)








severe OAS1 0.846 0.008 1.166153846 0.014056225 1.094998065 3.59E-158 6.34E-154 18CD4+ T helper






severe OAS1 0.583 0.018 0.968992248 0.021438451 0.946855158 0 0 1Naive CD4+ T cell

severe OAS1 0.696 0.034 1.354874042 0.039678284 1.179512722 0 0 2CD4+ T cell

severe OAS1 0.624 0.018 1.102439024 0.017873942 1.046505057 0 0 12Megakaryocyte progenitor cell



severe OAS1 0.657 0.049 1.294117647 0.048648649 1.129407996 0 0 25Megakaryocyte progenitor cell


severe OAS1 0.714 0.04 1.526315789 0.040462428 1.279810119 0 0 31CD8 cytoxict cells

severe OAS1 0.6 0.029 0.888888889 0.029411765 0.875717664 0 0 32Naive CD8+ T cell



severe OAS1 0.71 0.053 1.064516129 0.052631579 0.971803108 0 0 46B cell



severe OAS2 0.532 0.131 0.838150289 0.147058824 0.68031535 1.88E-26 3.32E-22 24T cell(Activated T cell)



severe OAS2 0.6 0.068 1 0.068181818 0.904842767 0 0 47AXL+SIGLEC6+ dendritic cell

severe OAS3 0.459 0 0.567567568 0 0.648527629 3.74E-13 6.60E-09 37CD8+ T cell

severe OAS3 0.564 0.155 0.961538462 0.177242888 0.736573616 7.99E-31 1.41E-26 21CD1C-CD141- dendritic cell



severe OAS3 0.4 0.03 0.8 0.030150754 0.805141428 0 0 34CD8 cytoxict cells


severe OASL 0.589 0.125 0.964285714 0.138613861 0.786726223 1.81E-17 3.19E-13 29CD8+ T cell

severe OASL 0.496 0.081 0.729323308 0.086705202 0.670246991 1.20E-18 2.12E-14 31CD8 cytoxict cells

severe OASL 0.52 0.089 0.81372549 0.1 0.721452595 1.62E-22 2.86E-18 25Megakaryocyte progenitor cell

severe OASL 0.601 0.052 0.965317919 0.078431373 0.865828337 2.44E-39 4.31E-35 24T cell(Activated T cell)

severe OASL 0.446 0.043 0.662371134 0.046938776 0.667065432 2.85E-52 5.04E-48 16CD8+ T cell

severe OASL 0.473 0.035 0.758007117 0.044444444 0.751205156 1.78E-60 3.14E-56 15CD1C+_B dendritic cell

severe OASL 0.516 0.15 0.811700183 0.193627451 0.601991604 9.45E-67 1.67E-62 4Effector CD8+ memory T (Tem) cell



severe OASL 0.62 0.065 0.908 0.077850877 0.823903579 6.81E-116 1.20E-111 9CD1C+_B dendritic cell

severe OASL 0.705 0.081 1.435897436 0.080962801 1.172136513 0 0 21CD1C-CD141- dendritic cell

severe PLSCR1 0.638 0.186 1.173913043 0.240310078 0.809593394 5.31E-11 9.37E-07 35Effector CD8+ memory T (Tem) cell

severe PLSCR1 0.377 0.034 0.695652174 0.040816327 0.704124765 3.95E-14 6.98E-10 28CD1C+_B dendritic cell

severe PLSCR1 0.318 0.01 0.675977654 0.015384615 0.722976607 2.07E-17 3.65E-13 27Megakaryocyte progenitor cell

severe PLSCR1 0.586 0.075 0.992481203 0.092485549 0.866951917 8.18E-23 1.44E-18 31CD8 cytoxict cells

severe PLSCR1 0.769 0.243 1.592592593 0.27826087 1.020213221 3.35E-23 5.90E-19 33Plasmacytoid dendritic cell

severe PLSCR1 0.393 0.085 0.734104046 0.091503268 0.667874013 3.49E-24 6.16E-20 24T cell(Activated T cell)


severe PLSCR1 0.528 0.131 0.838509317 0.147435897 0.680122929 1.57E-34 2.77E-30 19CD141+CLEC9A+ dendritic cell


severe PLSCR1 0.379 0.036 0.612765957 0.039344262 0.633863494 1.08E-39 1.90E-35 17CD4+ T cell




severe PLSCR1 0.769 0.309 1.961538462 0.396061269 1.084984564 1.44E-51 2.54E-47 21CD1C-CD141- dendritic cell












severe PLSCR1 0.539 0.07 0.859375 0.069620253 0.797719075 0 0 22CD8+ T cell




severe PLSCR1 0.457 0.078 0.685714286 0.077777778 0.645300287 0 0 41Naive CD8+ T cell

severe PLSCR1 0.471 0.065 0.911764706 0.065217391 0.843757084 0 0 44CD8 cytoxict cells

severe PLSCR1 0.522 0.246 0.869565217 0.245614035 0.585845693 0 0 45Plasmacytoid dendritic cell

severe RSAD2 0.335 0.005 0.905027933 0.01025641 0.915090646 2.62E-19 4.62E-15 27Megakaryocyte progenitor cell

severe RSAD2 0.425 0.018 0.6375 0.021775544 0.680416595 8.39E-25 1.48E-20 20CD141+CLEC9A+ dendritic cell

severe RSAD2 0.387 0.016 0.612716763 0.029411765 0.647672908 1.19E-26 2.10E-22 24T cell(Activated T cell)

severe RSAD2 0.235 0.001 0.71 0.003177966 0.769418759 7.16E-35 1.26E-30 14Megakaryocyte progenitor cell

severe RSAD2 0.41 0.044 0.833333333 0.04595186 0.809652665 2.33E-35 4.10E-31 21CD1C-CD141- dendritic cell

severe RSAD2 0.41 0.012 0.574742268 0.016326531 0.631751735 7.15E-56 1.26E-51 16CD8+ T cell

severe RSAD2 0.423 0.017 0.639553429 0.018656716 0.686634966 2.21E-125 3.91E-121 5Effector CD8+ memory T (Tem) cell



severe RSAD2 0.353 0.005 0.617647059 0.005405405 0.686119522 0 0 25Megakaryocyte progenitor cell

severe RSAD2 0.393 0.007 0.535714286 0.00660066 0.609418384 0 0 29CD8+ T cell

severe RSAD2 0.216 0.027 0.56281407 0.026548673 0.606344117 0 0 30CD1C-CD141- dendritic cell

severe RSAD2 0.398 0.012 0.62406015 0.011560694 0.683022182 0 0 31CD8 cytoxict cells

severe RSAD2 0.315 0.017 0.527777778 0.017391304 0.586560043 0 0 33Plasmacytoid dendritic cell

severe SAMD9L 0.526 0.139 0.804511278 0.156069364 0.642380198 8.21E-16 1.45E-11 31CD8 cytoxict cells

severe SAMD9L 0.447 0.156 0.825242718 0.179524153 0.629883364 1.12E-32 1.97E-28 8Effector CD8+ memory T (Tem) cell

severe SAMD9L 0.624 0.15 1.098265896 0.169934641 0.842769576 1.09E-34 1.92E-30 24T cell(Activated T cell)

severe SAMD9L 0.584 0.146 0.968944099 0.171474359 0.749096775 1.23E-36 2.18E-32 19CD141+CLEC9A+ dendritic cell

severe SAMD9L 0.505 0.136 0.76039604 0.15179606 0.612014739 9.67E-66 1.71E-61 10CD8+ T cell

severe SAMD9L 0.611 0.064 1.054794521 0.073903002 0.93613044 2.40E-98 4.24E-94 13CD141+CLEC9A+ dendritic cell



severe SAMD9L 0.405 0.057 0.621621622 0.057142857 0.617266881 0 0 37CD8+ T cell

severe SAMD9L 0.4 0.159 1 0.159090909 0.787006277 0 0 47AXL+SIGLEC6+ dendritic cell

severe SP110 0.667 0.319 1.222222222 0.387254902 0.679770193 3.75E-10 6.62E-06 32Naive CD8+ T cell

severe SP110 0.609 0.177 0.913043478 0.25170068 0.611980051 4.63E-11 8.17E-07 28CD1C+_B dendritic cell

severe SP110 0.667 0.233 1.246376812 0.263565891 0.83009905 1.27E-15 2.24E-11 35Effector CD8+ memory T (Tem) cell

severe SP110 0.628 0.159 1.115577889 0.353982301 0.643842922 3.50E-16 6.17E-12 30CD1C-CD141- dendritic cell

severe SP110 0.654 0.266 1.248120301 0.335260116 0.751598425 1.70E-17 3.00E-13 31CD8 cytoxict cells

severe SP110 0.654 0.279 1.058510638 0.34084507 0.618458356 1.26E-22 2.23E-18 23CD4+ T cell

severe SP110 0.733 0.281 1.3 0.334319527 0.785529674 3.09E-23 5.46E-19 26 T cell

severe SP110 0.686 0.249 1.31372549 0.316216216 0.813821206 2.67E-23 4.72E-19 25Megakaryocyte progenitor cell



severe SP110 0.746 0.317 1.479768786 0.392156863 0.832883832 9.96E-32 1.76E-27 24T cell(Activated T cell)

severe SP110 0.863 0.548 2.105590062 0.815705128 0.77433748 8.81E-38 1.55E-33 19CD141+CLEC9A+ dendritic cell





severe SP110 0.775 0.408 1.953424658 0.599307159 0.884941763 1.50E-69 2.65E-65 13CD141+CLEC9A+ dendritic cell

severe SP110 0.772 0.149 1.215384615 0.295180723 0.77440377 5.15E-83 9.08E-79 18CD4+ T helper





severe TRIM22 0.696 0.24 1.347826087 0.379844961 0.766819371 2.47E-09 4.35E-05 35Effector CD8+ memory T (Tem) cell

severe TRIM22 0.622 0.358 1.244444444 0.426470588 0.653908385 6.12E-11 1.08E-06 32Naive CD8+ T cell

severe TRIM22 0.679 0.267 1.142857143 0.333333333 0.684498174 2.09E-11 3.69E-07 29CD8+ T cell


severe TRIM22 0.829 0.289 1.742857143 0.759036145 0.640894356 2.31E-13 4.08E-09 38Plasmacytoid dendritic cell


severe TRIM22 0.667 0.29 1.155555556 0.366863905 0.657190141 1.99E-14 3.51E-10 26 T cell

severe TRIM22 0.722 0.272 1.406015038 0.346820809 0.837087742 1.23E-21 2.18E-17 31CD8 cytoxict cells

severe TRIM22 0.739 0.105 1.304347826 0.163265306 0.986178328 2.24E-24 3.96E-20 28CD1C+_B dendritic cell

severe TRIM22 0.7 0.28 1.375 0.350083752 0.814878606 6.25E-25 1.10E-20 20CD141+CLEC9A+ dendritic cell

severe TRIM22 0.667 0.311 1.274509804 0.364864865 0.736797536 4.14E-25 7.30E-21 25Megakaryocyte progenitor cell

severe TRIM22 0.692 0.33 1.230769231 0.411378556 0.660436282 1.49E-26 2.62E-22 21CD1C-CD141- dendritic cell


severe TRIM22 0.827 0.363 2.063583815 0.558823529 0.974762709 5.69E-32 1.00E-27 24T cell(Activated T cell)

severe TRIM22 0.859 0.186 1.869346734 0.318584071 1.121732757 4.45E-33 7.85E-29 30CD1C-CD141- dendritic cell




severe TRIM22 0.726 0.442 1.649315068 0.663972286 0.67098802 4.63E-43 8.18E-39 13CD141+CLEC9A+ dendritic cell








severe TRIM22 0.908 0.191 1.886153846 0.391566265 1.052438595 3.39E-111 5.98E-107 18CD4+ T helper




severe TRIM22 0.591 0.281 1.066322136 0.346127248 0.618250393 1.07E-155 1.89E-151 1Naive CD4+ T cell


severe TRIM22 0.715 0.01 0.804469274 0.01025641 0.836853072 0 0 27Megakaryocyte progenitor cell

severe TRIM22 0.8 0.114 1 0.113636364 0.844721775 0 0 47AXL+SIGLEC6+ dendritic cell

severe USP18 0.696 0.018 0.956521739 0.01754386 0.943200159 4.40E-09 7.76E-05 45Plasmacytoid dendritic cell

severe USP18 0.457 0.023 0.612716763 0.026143791 0.652260178 3.74E-32 6.60E-28 24T cell(Activated T cell)

severe USP18 0.481 0.061 0.648148148 0.060869565 0.635598642 0 0 33Plasmacytoid dendritic cell

severe USP18 0.4 0.02 1 0.020100503 0.971288703 0 0 34CD8 cytoxict cells

severe USP18 0.455 0.025 0.636363636 0.025 0.674869473 0 0 39CD141+CLEC9A+ dendritic cell

severe XAF1 0.783 0.088 1.391304348 0.105263158 1.113407848 3.72E-09 6.56E-05 45Plasmacytoid dendritic cell

severe XAF1 0.833 0.12 1.875 0.144578313 1.328745779 8.92E-12 1.57E-07 42Megakaryocyte progenitor cell

severe XAF1 0.935 0.184 4.258064516 0.289473684 2.027749513 1.07E-12 1.89E-08 46B cell

severe XAF1 0.912 0.304 2.264705882 0.326086957 1.299777644 4.62E-15 8.16E-11 44CD8 cytoxict cells

severe XAF1 0.955 0.168 1.954545455 0.205607477 1.293175925 4.21E-15 7.43E-11 40CD8+ T cell




severe XAF1 0.822 0.132 2.2 0.166666667 1.455679484 1.13E-24 2.00E-20 32Naive CD8+ T cell


severe XAF1 0.971 0.217 2.985507246 0.379844961 1.530257176 1.22E-29 2.15E-25 35Effector CD8+ memory T (Tem) cell



severe XAF1 0.942 0.085 2.550724638 0.115646259 1.670233822 1.91E-51 3.36E-47 28CD1C+_B dendritic cell

severe XAF1 0.811 0.151 2.577777778 0.177514793 1.603318598 4.14E-52 7.31E-48 26 T cell

severe XAF1 0.925 0.191 2.789473684 0.219653179 1.635526527 2.65E-57 4.68E-53 31CD8 cytoxict cells

severe XAF1 0.965 0.097 2.020100503 0.168141593 1.370381403 8.65E-59 1.53E-54 30CD1C-CD141- dendritic cell

severe XAF1 0.938 0.178 2.675 0.221105528 1.589556367 3.51E-70 6.19E-66 20CD141+CLEC9A+ dendritic cell

severe XAF1 0.872 0.291 1.929487179 0.334792123 1.134033059 7.51E-76 1.33E-71 21CD1C-CD141- dendritic cell

severe XAF1 0.931 0.239 2.924855491 0.31372549 1.578975688 1.08E-76 1.91E-72 24T cell(Activated T cell)












severe XAF1 0.997 0.064 2.458461538 0.112449799 1.636390178 5.53E-197 9.75E-193 18CD4+ T helper

severe XAF1 1 0.001 1.38 0.003177966 1.246384007 4.36E-227 7.69E-223 14Megakaryocyte progenitor cell






severe XAF1 0.863 0.137 2.321274763 0.161825726 1.515343399 0 0 1Naive CD4+ T cell

severe XAF1 0.885 0.157 2.415115005 0.187131367 1.524454571 0 0 2CD4+ T cell

severe XAF1 0.933 0.01 1.173184358 0.020512821 1.090516261 0 0 27Megakaryocyte progenitor cell

severe XAF1 0.829 0.133 2 0.133333333 1.404390255 0 0 41Naive CD8+ T cell

moderate BST2 0.602 0.279 1.070532915 0.355191257 0.611505665 8.88E-21 1.65E-16 37CD8+ T cell

moderate BST2 0.601 0.092 1.015317287 0.18487395 0.766273402 7.53E-27 1.40E-22 33CD1C+_B dendritic cell

moderate BST2 0.803 0.508 1.974580336 0.836065574 0.696068558 5.54E-100 1.03E-95 16Effector CD8+ memory T (Tem) cell

moderate BST2 0.857 0.61 2.268122677 1.037148594 0.681910922 3.34E-107 6.22E-103 12Plasmacytoid dendritic cell

moderate BST2 0.773 0.471 1.732150227 0.691368078 0.691846157 3.67E-133 6.82E-129 7Plasmacytoid dendritic cell

moderate EPSTI1 0.291 0.066 0.715662651 0.094890511 0.647979297 1.66E-11 3.09E-07 26CD1C-CD141- dendritic cell

moderate EPSTI1 0.376 0.04 0.876201923 0.083333333 0.792337886 2.29E-31 4.25E-27 31Megakaryocyte progenitor cell

moderate EPSTI1 0.733 0.309 1.357262104 0.409547739 0.74187984 1.28E-49 2.38E-45 34CD1C-CD141- dendritic cell

moderate EPSTI1 0.768 0.271 1.372717508 0.356589147 0.806556489 5.12E-52 9.52E-48 28CD141+CLEC9A+ dendritic cell

moderate EPSTI1 0.491 0.089 0.904381085 0.117728532 0.768752368 2.84E-106 5.28E-102 8CD1C+_B dendritic cell

moderate EPSTI1 0.707 0.246 1.230971129 0.335266821 0.740543784 8.03E-140 1.49E-135 6CD1C+_B dendritic cell

moderate IFI27 0.333 0 0.68627451 0 0.753839413 5.57E-11 1.04E-06 47Plasmacytoid dendritic cell

moderate IFI27 0.364 0 2.30529595 0 1.724779454 1.17E-11 2.17E-07 43Plasmacytoid dendritic cell

moderate IFI27 0.271 0.036 1.236272879 0.043165468 1.100128225 3.29E-13 6.12E-09 39Plasmacytoid dendritic cell

moderate IFI27 0.329 0 2.892778993 0 1.96080044 5.35E-19 9.94E-15 33CD1C+_B dendritic cell

moderate IFI27 0.539 0 1.086474501 0 1.061067289 7.51E-23 1.40E-18 40Megakaryocyte progenitor cell

moderate IFI27 0.394 0 1.451405622 0 1.29360922 1.38E-27 2.56E-23 26CD1C-CD141- dendritic cell

moderate IFI27 0.693 0.015 3.438972163 0.044117647 2.087941383 5.33E-60 9.91E-56 20Megakaryocyte progenitor cell


moderate IFI27 0.56 0.012 12.13748657 0.031007752 3.671562205 2.49E-73 4.62E-69 28CD141+CLEC9A+ dendritic cell

moderate IFI27 0.673 0 3.460336538 0 2.157152568 1.22E-104 2.28E-100 31Megakaryocyte progenitor cell

moderate IFI27 0.693 0.003 16.27378965 0.002512563 4.106892406 7.34E-132 1.37E-127 34CD1C-CD141- dendritic cell

moderate IFI27 0.519 0.001 5.35605007 0.002770083 2.664139629 7.91E-192 1.47E-187 8CD1C+_B dendritic cell



moderate IFI27 0.811 0.006 8.778201866 0.01285347 3.271143715 0 0 14Megakaryocyte progenitor cell

moderate IFI27 0.439 0.009 1.068340307 0.009259259 1.035176751 0 0 36T cell

moderate IFI27 0.15 0.011 0.626959248 0.010928962 0.686496492 0 0 37CD8+ T cell

moderate IFI44L 0.687 0.056 1.445783133 0.138888889 1.102669483 5.17E-10 9.61E-06 49AXL+SIGLEC6+ dendritic cell

moderate IFI44L 0.488 0.02 0.90234375 0.030612245 0.884276323 5.19E-19 9.65E-15 45CD8+ T cell

moderate IFI44L 0.519 0.013 0.898004435 0.012987013 0.905867685 4.21E-19 7.82E-15 40Megakaryocyte progenitor cell

moderate IFI44L 0.399 0.017 0.68380744 0.025210084 0.715807587 2.39E-20 4.45E-16 33CD1C+_B dendritic cell

moderate IFI44L 0.657 0.053 2.058823529 0.105263158 1.468586968 5.74E-21 1.07E-16 47Plasmacytoid dendritic cell



moderate IFI44L 0.586 0.066 1.887550201 0.138686131 1.342475892 5.36E-34 9.97E-30 26CD1C-CD141- dendritic cell


moderate IFI44L 0.354 0.011 0.591709845 0.014285714 0.650113266 2.42E-47 4.51E-43 27Effector CD8+ memory T (Tem) cell

moderate IFI44L 0.43 0 0.75 0 0.807354922 7.01E-61 1.30E-56 30Megakaryocyte progenitor cell



moderate IFI44L 0.543 0.029 0.956953642 0.058651026 0.886382483 3.75E-78 6.98E-74 24Naive CD8+ T cell

moderate IFI44L 0.718 0.078 1.327604726 0.093023256 1.090521984 2.00E-84 3.72E-80 28CD141+CLEC9A+ dendritic cell



moderate IFI44L 0.509 0.008 1.401785714 0.020449898 1.23490209 1.66E-114 3.08E-110 21T cell (Activated T cell)







moderate IFI44L 0.499 0.025 0.957314149 0.032786885 0.922332741 1.13E-184 2.11E-180 16Effector CD8+ memory T (Tem) cell



moderate IFI44L 0.542 0.015 0.963963964 0.018427518 0.947425151 5.45E-223 1.01E-218 4Megakaryocyte progenitor cell


moderate IFI44L 0.493 0.027 0.833229362 0.033293221 0.827137587 0 0 1CD8+ T cell

moderate IFI44L 0.555 0.058 1.040734487 0.071602533 0.929318594 0 0 2Activated CD4+ T cell


moderate IFI44L 0.63 0.049 1.343686502 0.061882818 1.142155035 0 0 5CD141+CLEC9A+ dendritic cell

moderate IFI44L 0.433 0.022 0.620985011 0.022058824 0.665392519 0 0 20Megakaryocyte progenitor cell


moderate IFI44L 0.499 0.019 0.828451883 0.018518519 0.84415045 0 0 36T cell





moderate IFI6 0.88 0.333 3.457831325 0.444444444 1.625827312 3.40E-13 6.33E-09 49AXL+SIGLEC6+ dendritic cell

moderate IFI6 0.53 0.235 1.064263323 0.289617486 0.678683805 7.96E-21 1.48E-16 37CD8+ T cell




moderate IFI6 0.485 0.148 0.863319386 0.157407407 0.686978201 1.54E-32 2.87E-28 36T cell








moderate IFI6 0.484 0.045 0.853708791 0.077709611 0.782446125 1.35E-83 2.52E-79 21T cell (Activated T cell)





moderate IFI6 0.518 0.158 0.946313529 0.177251185 0.725321956 8.93E-124 1.66E-119 19Effector CD8+ memory T (Tem) cell

moderate IFI6 0.936 0.205 3.948442535 0.279069767 1.951879566 2.08E-149 3.87E-145 28CD141+CLEC9A+ dendritic cell





moderate IFI6 0.512 0.161 0.92971718 0.196785192 0.689225191 1.18E-216 2.19E-212 2Activated CD4+ T cell




moderate IFI6 0.968 0.362 4.396653543 0.636890951 1.721106858 0 0 6CD1C+_B dendritic cell

moderate IFI6 0.434 0.136 0.716981132 0.136363636 0.595449614 0 0 48T cell

moderate IFIT3 0.591 0.196 1.135225376 0.253768844 0.768116971 4.87E-43 9.07E-39 34CD1C-CD141- dendritic cell

moderate IFIT3 0.367 0.027 0.550943396 0.032916392 0.586422552 2.44E-178 4.54E-174 5CD141+CLEC9A+ dendritic cell

moderate IFITM1 0.783 0.083 2.771084337 0.166666667 1.692586994 2.10E-12 3.90E-08 49AXL+SIGLEC6+ dendritic cell

moderate IFITM1 0.732 0.396 3.212978369 1.158273381 0.964962891 1.63E-14 3.03E-10 39Plasmacytoid dendritic cell

moderate IFITM1 1 0.986 9.494661922 4.890410959 0.833215496 1.94E-20 3.60E-16 44CD8+ T cell


moderate IFITM1 0.996 0.961 9.33037694 4.454545455 0.921362015 7.31E-23 1.36E-18 40Megakaryocyte progenitor cell

moderate IFITM1 0.996 0.98 10.4140625 5.142857143 0.89383063 5.64E-23 1.05E-18 45CD8+ T cell

moderate IFITM1 0.992 0.942 4.001606426 2.051094891 0.713064488 5.91E-24 1.10E-19 26CD1C-CD141- dendritic cell



moderate IFITM1 0.999 0.981 11.28870293 5.837962963 0.845694134 8.01E-43 1.49E-38 36T cell




moderate IFITM1 1 0.987 15.40492958 8.204545455 0.833711016 2.14E-54 3.97E-50 30Megakaryocyte progenitor cell


moderate IFITM1 0.998 0.962 10.65149007 5.214076246 0.906902619 1.61E-89 3.00E-85 24Naive CD8+ T cell

moderate IFITM1 0.998 0.937 10.8746114 4.671428571 1.066096216 9.73E-96 1.81E-91 27Effector CD8+ memory T (Tem) cell


moderate IFITM1 0.828 0.151 5.272824919 0.348837209 2.217399056 2.83E-100 5.27E-96 28CD141+CLEC9A+ dendritic cell









moderate IFITM1 0.639 0.092 3.247703412 0.226218097 1.792467434 5.93E-206 1.10E-201 6CD1C+_B dendritic cell




moderate IFITM1 1 0.997 20.44604317 10.48463115 0.90100697 3.37E-235 6.27E-231 16Effector CD8+ memory T (Tem) cell



moderate IFITM1 1 0.999 24.0464684 13.41666667 0.796869563 4.54E-258 8.45E-254 12Plasmacytoid dendritic cell

moderate IFITM1 1 0.995 18.35905902 10.23289902 0.785278518 5.69E-259 1.06E-254 7Plasmacytoid dendritic cell

moderate IFITM1 1 0.996 17.17410495 8.650323774 0.913235064 2.24E-262 4.17E-258 15Effector CD8+ memory T (Tem) cell

moderate IFITM1 0.998 0.976 9.999584113 5.019253911 0.869792397 0 0 1CD8+ T cell

moderate IFITM1 0.999 0.972 13.13381173 6.411592791 0.931295073 0 0 2Activated CD4+ T cell

moderate IFITM1 0.999 0.963 9.974558572 4.76880985 0.927817296 0 0 3CD8+ T cell

moderate IFITM1 0.938 0.362 4.95820029 0.540487163 1.951489962 0 0 5CD141+CLEC9A+ dendritic cell









moderate IFITM3 0.72 0.574 2.39888424 1.12037037 0.680744941 5.64E-16 1.05E-11 36T cell



moderate IFITM3 0.988 0.924 12.81619256 4 1.466360095 2.63E-25 4.90E-21 33CD1C+_B dendritic cell









moderate IFITM3 1 1 39.19532554 18.08291457 1.074746201 1.11E-164 2.06E-160 34CD1C-CD141- dendritic cell


moderate IFITM3 1 0.923 23.31856955 4.738979118 2.08319234 0 0 6CD1C+_B dendritic cell

moderate IFITM3 1 0.87 20.15924896 3.44598338 2.25071396 0 0 8CD1C+_B dendritic cell

moderate IFITM3 0.976 0.874 6.541560645 1.086118252 1.854042165 0 0 14Megakaryocyte progenitor cell

moderate IRF1 0.558 0.741 1.068585132 2.200819672 -0.629797068 1.06E-71 1.97E-67 16Effector CD8+ memory T (Tem) cell

moderate IRF7 0.499 0.134 0.769706975 0.157166124 0.612914507 5.42E-130 1.01E-125 7Plasmacytoid dendritic cell

moderate ISG15 0.445 0.11 0.717277487 0.127118644 0.60748379 9.76E-11 1.82E-06 46CD8+ T cell

moderate ISG15 0.352 0.058 0.950200803 0.131386861 0.785530357 3.80E-15 7.06E-11 26CD1C-CD141- dendritic cell

moderate ISG15 0.548 0.118 1.273522976 0.201680672 0.91987601 8.70E-21 1.62E-16 33CD1C+_B dendritic cell

moderate ISG15 0.505 0.162 0.947001395 0.203703704 0.693773607 4.35E-24 8.08E-20 36T cell

moderate ISG15 0.684 0.252 2.018302829 0.402877698 1.105348319 1.92E-24 3.58E-20 39Plasmacytoid dendritic cell




moderate ISG15 0.493 0.114 0.849337748 0.134897361 0.704446904 2.28E-44 4.24E-40 24Naive CD8+ T cell



moderate ISG15 0.603 0.218 1.376760563 0.25 0.927068478 4.29E-55 7.98E-51 30Megakaryocyte progenitor cell


moderate ISG15 0.376 0.031 0.717032967 0.051124744 0.707983845 3.12E-61 5.80E-57 21T cell (Activated T cell)




moderate ISG15 0.799 0.24 2.148227712 0.317829457 1.256376214 7.23E-74 1.34E-69 28CD141+CLEC9A+ dendritic cell




moderate ISG15 0.49 0.209 0.887616321 0.23507109 0.611971465 4.69E-102 8.72E-98 19Effector CD8+ memory T (Tem) cell








moderate ISG15 0.455 0.125 0.843251089 0.148782093 0.682147442 1.99E-156 3.70E-152 5CD141+CLEC9A+ dendritic cell




moderate ISG15 0.586 0.213 1.282608696 0.271310278 0.844367382 1.71E-265 3.19E-261 2Activated CD4+ T cell


moderate ISG15 0.451 0.068 0.712230216 0.067567568 0.681549308 0 0 41CD8+ T cell

moderate ISG15 0.474 0.06 0.881619938 0.059701493 0.828317323 0 0 43Plasmacytoid dendritic cell

moderate ISG15 0.505 0.11 0.832740214 0.109589041 0.723976858 0 0 44CD8+ T cell


moderate MT2A 0.685 0.566 3.254564984 1.546511628 0.740489323 2.16E-12 4.02E-08 28CD141+CLEC9A+ dendritic cell

moderate MT2A 0.917 0.764 7.532554257 3.48241206 0.928702404 1.87E-28 3.47E-24 34CD1C-CD141- dendritic cell

moderate MT2A 0.485 0.521 0.917050691 2.0546875 -0.672136312 3.44E-50 6.41E-46 22CD1C-CD141- dendritic cell

moderate MT2A 0.812 0.626 4.17191601 1.953596288 0.808226202 1.76E-56 3.28E-52 6CD1C+_B dendritic cell

moderate MT2A 0.736 0.373 3.472878999 0.965373961 1.186399884 1.10E-95 2.05E-91 8CD1C+_B dendritic cell

moderate MT2A 0.484 0.015 0.595419847 0.038560411 0.619350993 7.77E-169 1.45E-164 14Megakaryocyte progenitor cell

moderate MX1 0.333 0.05 0.741794311 0.100840336 0.661969027 6.17E-12 1.15E-07 33CD1C+_B dendritic cell

moderate MX1 0.375 0.044 1.095582329 0.094890511 0.936564594 8.19E-18 1.52E-13 26CD1C-CD141- dendritic cell

moderate MX1 0.421 0.065 0.644351464 0.074074074 0.614425201 2.89E-27 5.38E-23 36T cell

moderate MX1 0.531 0.096 0.998714653 0.101522843 0.859573107 2.06E-39 3.83E-35 35Plasmacytoid dendritic cell

moderate MX1 0.653 0.211 1.273789649 0.33919598 0.763731693 3.40E-44 6.32E-40 34CD1C-CD141- dendritic cell

moderate MX1 0.67 0.167 1.276047261 0.282945736 0.827070363 1.73E-47 3.21E-43 28CD141+CLEC9A+ dendritic cell

moderate MX1 0.38 0.057 1.004807692 0.122699387 0.836492171 1.53E-49 2.84E-45 21T cell (Activated T cell)

moderate MX1 0.43 0.082 0.641758242 0.088967972 0.592280175 3.73E-56 6.93E-52 25CD8+ T cell




moderate MX1 0.492 0.061 0.891606715 0.094262295 0.789653574 1.32E-139 2.46E-135 16Effector CD8+ memory T (Tem) cell




moderate MX1 0.474 0.135 0.831785564 0.171456405 0.644947359 7.44E-193 1.38E-188 2Activated CD4+ T cell

moderate MX1 0.404 0.036 0.616197183 0.035714286 0.641977151 0 0 30Megakaryocyte progenitor cell

moderate MX1 0.445 0.033 0.896551724 0.032786885 0.876836132 0 0 37CD8+ T cell

moderate PLSCR1 0.334 0.025 0.777899344 0.042016807 0.770795101 6.83E-15 1.27E-10 33CD1C+_B dendritic cell

moderate PLSCR1 0.666 0.307 1.228714524 0.394472362 0.676492493 8.95E-41 1.66E-36 34CD1C-CD141- dendritic cell

moderate XAF1 0.449 0.09 0.763239875 0.104477612 0.674864581 4.90E-09 9.12E-05 43Plasmacytoid dendritic cell

moderate XAF1 0.52 0.164 0.768683274 0.178082192 0.586235526 6.79E-10 1.26E-05 44CD8+ T cell



moderate XAF1 0.435 0.073 1.034538153 0.138686131 0.837331199 3.66E-18 6.81E-14 26CD1C-CD141- dendritic cell

moderate XAF1 0.501 0.084 0.90809628 0.12605042 0.760862543 1.11E-19 2.07E-15 33CD1C+_B dendritic cell


moderate XAF1 0.505 0.157 0.873082287 0.199074074 0.643493495 6.26E-23 1.16E-18 36T cell


moderate XAF1 0.547 0.234 0.917098446 0.271428571 0.592474009 1.39E-37 2.59E-33 27Effector CD8+ memory T (Tem) cell


moderate XAF1 0.561 0.179 0.968309859 0.220779221 0.689155042 1.54E-38 2.86E-34 30Megakaryocyte progenitor cell


moderate XAF1 0.515 0.141 0.814569536 0.161290323 0.643898653 1.98E-44 3.69E-40 24Naive CD8+ T cell

moderate XAF1 0.672 0.252 1.026852846 0.282945736 0.659781199 1.50E-44 2.80E-40 28CD141+CLEC9A+ dendritic cell



moderate XAF1 0.461 0.08 1.096153846 0.130879346 0.890299591 3.36E-64 6.25E-60 21T cell (Activated T cell)

moderate XAF1 0.535 0.17 0.982962448 0.253462604 0.661738402 3.82E-77 7.11E-73 8CD1C+_B dendritic cell














moderate XAF1 0.558 0.181 0.905445336 0.218217243 0.64535679 9.88E-236 1.84E-231 2Activated CD4+ T cell

cured BST2 0.721 0.331 1.23255814 0.43236715 0.640296409 4.06E-09 7.13E-05 25CD8+ T cell

cured BST2 0.654 0.231 2.012345679 0.444444444 1.060372618 1.00E-09 1.76E-05 34CD1C-CD141- dendritic cell

cured BST2 0.93 0.716 2.253521127 1.106382979 0.627234154 1.83E-10 3.21E-06 30CD141+CLEC9A+ dendritic cell


cured BST2 0.814 0.433 1.617647059 0.605769231 0.705006015 9.61E-11 1.69E-06 31Plasmacytoid dendritic cell


cured BST2 0.5 0.033 0.65625 0.04111986 0.669784285 3.47E-13 6.09E-09 13Megakaryocyte progenitor cell


cured BST2 0.725 0.393 1.431372549 0.51988218 0.677811477 9.18E-14 1.61E-09 19CD4+ cytotoxic T cell

cured BST2 0.937 0.775 2.742138365 1.4 0.640828497 1.99E-24 3.50E-20 22CD1C-CD141- dendritic cell

cured BST2 0.658 0.345 1.222088836 0.452008929 0.61386617 4.85E-97 8.52E-93 3Effector CD8+ memory T (Tem) cell



cured BST2 0.596 0.259 1.038461538 0.259259259 0.694905397 0 0 39CD8+ T cell

cured EPSTI1 0.831 0.234 1.478873239 0.304964539 0.925673895 5.78E-18 1.01E-13 30CD141+CLEC9A+ dendritic cell

cured EPSTI1 0.598 0.227 1.042735043 0.301136364 0.650729919 5.18E-27 9.10E-23 18Memory B cell

cured EPSTI1 0.811 0.302 1.635220126 0.395454545 0.917188347 3.70E-41 6.49E-37 22CD1C-CD141- dendritic cell

cured EPSTI1 0.589 0.226 1 0.304958678 0.615995876 4.70E-59 8.24E-55 9CD1C+_B dendritic cell

cured EPSTI1 0.536 0.103 0.785714286 0.103448276 0.694482263 0 0 40Plasmacytoid dendritic cell

cured IFI27 0.132 0.006 1.170940171 0.011363636 1.102018155 7.10E-14 1.25E-09 18Memory B cell

cured IFI27 0.265 0 1.451162791 0 1.293466302 9.31E-31 1.63E-26 20CD1C+_B dendritic cell

cured IFI27 0.237 0.006 2.422697368 0.017355372 1.750310022 2.77E-65 4.87E-61 9CD1C+_B dendritic cell

cured IFI27 0.61 0.005 15.3081761 0.009090909 4.014467383 6.82E-68 1.20E-63 22CD1C-CD141- dendritic cell

cured IFI27 0.4 0.045 3.551515152 0.045454545 2.122216546 0 0 29Plasmacytoid dendritic cell

cured IFI44L 0.786 0.121 1.928571429 0.172413793 1.320715236 2.29E-09 4.02E-05 40Plasmacytoid dendritic cell

cured IFI44L 0.429 0.05 0.761904762 0.066115702 0.724771925 3.44E-10 6.03E-06 32Effector CD8+ memory T (Tem) cell

cured IFI44L 0.556 0.083 1.864197531 0.175925926 1.284333808 1.26E-12 2.21E-08 34CD1C-CD141- dendritic cell

cured IFI44L 0.648 0.064 1.521126761 0.070921986 1.235215271 2.43E-22 4.26E-18 30CD141+CLEC9A+ dendritic cell

cured IFI44L 0.415 0.061 0.769230769 0.085227273 0.705125029 1.80E-30 3.16E-26 18Memory B cell

cured IFI44L 0.251 0.01 0.644028103 0.023904382 0.683153965 2.32E-32 4.07E-28 17T cell (Activated T cell)

cured IFI44L 0.616 0.082 1.062893082 0.095454545 0.913139427 5.64E-45 9.90E-41 22CD1C-CD141- dendritic cell


cured IFI44L 0.415 0.058 0.680379747 0.068389058 0.653350197 2.69E-105 4.73E-101 4CD4+ T cell


cured IFI44L 0.418 0.016 0.662921348 0.022906228 0.701046039 6.77E-137 1.19E-132 6Effector CD8+ memory T (Tem) cell

cured IFI44L 0.681 0.117 1.434210526 0.16446281 1.063789383 5.42E-147 9.52E-143 9CD1C+_B dendritic cell

cured IFI44L 0.5 0.176 1.166666667 0.176470588 0.881011964 0 0 45CD1C-CD141- dendritic cell

cured IFI6 0.6 0.258 1.224242424 0.303030303 0.771443403 3.72E-09 6.53E-05 29Plasmacytoid dendritic cell


cured IFI6 0.5 0.212 0.931372549 0.230769231 0.650066196 6.12E-12 1.07E-07 31Plasmacytoid dendritic cell


cured IFI6 0.803 0.113 1.774647887 0.14893617 1.272006049 1.06E-24 1.86E-20 30CD141+CLEC9A+ dendritic cell



cured IFIT1 0.484 0.059 0.874213836 0.068181818 0.811128332 8.28E-33 1.45E-28 22CD1C-CD141- dendritic cell



cured IFIT3 0.408 0.043 0.605633803 0.042553191 0.623021902 0 0 30CD141+CLEC9A+ dendritic cell

cured IFITM1 0.636 0.273 2.715151515 0.515151515 1.293958979 4.83E-09 8.48E-05 29Plasmacytoid dendritic cell

cured IFITM1 1 1 13.8 8.809836066 0.593296243 1.83E-09 3.22E-05 26CD8+ T cell

cured IFITM1 1 0.902 11.52941176 4.12195122 1.290553266 1.52E-11 2.67E-07 42CD8+ T cell


cured IFITM1 0.648 0.156 2.521126761 0.418439716 1.311732328 4.55E-12 7.98E-08 30CD141+CLEC9A+ dendritic cell

cured IFITM1 1 0.991 16.21568627 8.877761414 0.801467665 4.81E-13 8.44E-09 19CD4+ cytotoxic T cell


cured IFITM1 1 0.967 7.78125 4.618905473 0.64413719 3.82E-15 6.71E-11 14Megakaryocyte progenitor cell


cured IFITM1 1 0.969 9.25 5.238636364 0.716321284 1.08E-16 1.89E-12 24T cell

cured IFITM1 1 0.978 3.90625 2.045494313 0.687944338 1.96E-18 3.44E-14 13Megakaryocyte progenitor cell

cured IFITM1 0.996 0.965 9.697478992 5.279538905 0.768540312 9.69E-27 1.70E-22 23CD4+ T cell


cured IFITM1 1 0.904 10.56862745 3.520477816 1.355670528 1.50E-31 2.63E-27 21Plasmacytoid dendritic cell

cured IFITM1 1 0.993 13.16216216 7.043657331 0.816118013 1.48E-33 2.60E-29 10Effector CD8+ memory T (Tem) cell

cured IFITM1 0.995 0.823 3.009302326 1.55387931 0.650660861 2.62E-34 4.60E-30 20CD1C+_B dendritic cell

cured IFITM1 0.987 0.941 15.48717949 7.659090909 0.92905714 1.21E-35 2.12E-31 18Memory B cell


cured IFITM1 1 1 8.276346604 4.125498008 0.855864539 7.93E-48 1.39E-43 17T cell (Activated T cell)





cured IFITM1 0.956 0.389 8.264150943 1.070454545 2.161711229 8.59E-79 1.51E-74 22CD1C-CD141- dendritic cell

cured IFITM1 0.997 0.982 9.564176245 5.467569494 0.70788472 3.70E-101 6.50E-97 5Naive CD8+ T cell





cured IFITM2 0.867 0.634 2.390625 1.21875 0.611804113 2.34E-13 4.10E-09 24T cell


cured IFITM2 0.941 0.703 3.843137255 1.511945392 0.947136788 8.79E-16 1.54E-11 21Plasmacytoid dendritic cell







cured IFITM3 0.969 0.825 2.1875 1.052493438 0.635047732 6.31E-17 1.11E-12 13Megakaryocyte progenitor cell




cured IFITM3 1 1 43.21383648 17.86363636 1.228890111 2.47E-65 4.34E-61 22CD1C-CD141- dendritic cell


cured IRF1 0.831 0.475 1.784615385 0.744262295 0.674861071 9.09E-10 1.60E-05 26CD8+ T cell

cured IRF1 0.767 0.372 2 0.560386473 0.943059104 5.42E-13 9.51E-09 25CD8+ T cell

cured IRF1 0.843 0.487 2.607843137 0.826215022 0.982279973 1.54E-17 2.71E-13 19CD4+ cytotoxic T cell

cured IRF1 0.774 0.423 1.889555822 0.702566964 0.763136199 3.08E-103 5.40E-99 3Effector CD8+ memory T (Tem) cell



cured IRF7 0.718 0.291 1.535211268 0.368794326 0.889200292 1.41E-13 2.48E-09 30CD141+CLEC9A+ dendritic cell

cured IRF7 0.471 0.061 0.666666667 0.071672355 0.6371017 9.77E-15 1.71E-10 21Plasmacytoid dendritic cell

cured IRF7 0.529 0.091 0.784313725 0.103092784 0.693815154 5.51E-16 9.68E-12 19CD4+ cytotoxic T cell



cured IRF7 0.792 0.455 1.748427673 0.627272727 0.75615045 7.89E-29 1.39E-24 22CD1C-CD141- dendritic cell






cured ISG15 0.569 0.179 0.921568627 0.216723549 0.65928309 2.67E-12 4.69E-08 21Plasmacytoid dendritic cell

cured ISG15 0.677 0.281 2 0.366515837 1.134460321 1.24E-13 2.18E-09 28CD8+ T cell


cured ISG15 0.523 0.134 0.920454545 0.152439024 0.736757398 8.38E-15 1.47E-10 27CD8+ T cell

cured ISG15 0.377 0.095 0.879069767 0.170258621 0.68319124 1.12E-17 1.96E-13 20CD1C+_B dendritic cell


cured ISG15 0.803 0.17 1.971830986 0.205673759 1.301512485 3.47E-24 6.10E-20 30CD141+CLEC9A+ dendritic cell

cured ISG15 0.477 0.203 0.891891892 0.232289951 0.618487898 9.15E-36 1.61E-31 10Effector CD8+ memory T (Tem) cell

cured ISG15 0.645 0.297 1.948717949 0.452651515 1.021399184 3.14E-37 5.51E-33 18Memory B cell

cured ISG15 0.887 0.448 2.691823899 0.684090909 1.132363719 1.44E-44 2.52E-40 22CD1C-CD141- dendritic cell

cured ISG15 0.651 0.293 1.75 0.495867769 0.878448969 8.84E-69 1.55E-64 9CD1C+_B dendritic cell




cured ISG15 0.357 0.034 0.642857143 0.034482759 0.667297434 0 0 40Plasmacytoid dendritic cell

cured ISG15 0.559 0.22 1.205882353 0.219512195 0.855051664 0 0 42CD8+ T cell

cured ISG15 0.882 0.113 1 0.113207547 0.845277405 0 0 43AXL+SIGLEC6+ dendritic cell



cured ISG20 0.781 0.055 0.96875 0.074365704 0.873794766 1.09E-22 1.92E-18 13Megakaryocyte progenitor cell

cured ISG20 0.765 0.151 1.823529412 0.150943396 1.294682776 0 0 43AXL+SIGLEC6+ dendritic cell

cured ISG20 0.833 0.294 1.666666667 0.294117647 1.043068722 0 0 45CD1C-CD141- dendritic cell

cured MT2A 0.662 0.542 2.512820513 1.238636364 0.650009663 2.63E-11 4.62E-07 18Memory B cell

cured MT2A 0.406 0.023 0.875 0.055993001 0.828290323 1.99E-13 3.50E-09 13Megakaryocyte progenitor cell

cured MX1 0.732 0.213 1.887323944 0.368794326 1.076827295 2.02E-13 3.54E-09 30CD141+CLEC9A+ dendritic cell

cured MX1 0.667 0.163 2.029411765 0.25 1.277109591 2.42E-15 4.25E-11 31Plasmacytoid dendritic cell

cured MX1 0.629 0.207 1.150943396 0.336363636 0.686656928 2.06E-20 3.61E-16 22CD1C-CD141- dendritic cell

cured MX1 0.316 0.06 0.906323185 0.12749004 0.757678036 1.64E-25 2.88E-21 17T cell (Activated T cell)

cured MX1 0.603 0.182 1.491452991 0.297348485 0.941421295 2.37E-32 4.16E-28 18Memory B cell


cured MX1 0.434 0.096 0.736842105 0.106169297 0.650894402 7.73E-44 1.36E-39 15CD4+ T cell

cured MX1 0.633 0.212 1.470394737 0.403305785 0.815912173 3.14E-72 5.51E-68 9CD1C+_B dendritic cell


cured MX1 0.474 0.077 0.797752809 0.100930565 0.707471181 2.28E-106 4.01E-102 6Effector CD8+ memory T (Tem) cell

cured MX1 0.381 0.049 0.618512111 0.065298507 0.603410416 3.50E-112 6.15E-108 2Effector CD8+ memory T (Tem) cell

cured MX1 0.487 0.119 0.767405063 0.130192503 0.645064199 2.01E-123 3.53E-119 4CD4+ T cell

cured MX1 0.435 0.091 0.75862069 0.099073414 0.678156591 4.67E-125 8.21E-121 5Naive CD8+ T cell

cured MX1 0.341 0.03 0.659090909 0.030487805 0.687065509 0 0 27CD8+ T cell

cured MX1 0.351 0.094 0.648648649 0.094202899 0.591403689 0 0 35CD8+ T cell


cured OAS1 0.648 0.199 1 0.226950355 0.704923125 3.42E-12 6.00E-08 30CD141+CLEC9A+ dendritic cell

cured OAS1 0.333 0.027 0.568627451 0.030716724 0.605854868 1.27E-13 2.23E-09 21Plasmacytoid dendritic cell

cured OAS1 0.471 0.043 0.647058824 0.045655376 0.655484631 3.83E-20 6.72E-16 19CD4+ cytotoxic T cell

cured OAS1 0.899 0.752 3.333333333 1.645454545 0.711961588 2.31E-20 4.05E-16 22CD1C-CD141- dendritic cell

cured OAS1 0.588 0.236 1.044776119 0.337142857 0.612789285 4.56E-32 8.00E-28 16CD141+CLEC9A+ dendritic cell

cured OAS1 0.487 0.087 0.923076923 0.113636364 0.788138246 3.63E-36 6.36E-32 18Memory B cell

cured OAS1 0.476 0.119 0.758723829 0.151794872 0.610645151 2.73E-75 4.79E-71 8CD141+CLEC9A+ dendritic cell

cured OAS1 0.453 0.069 0.669163546 0.078740157 0.629777921 2.17E-109 3.80E-105 6Effector CD8+ memory T (Tem) cell

cured OAS1 0.512 0.039 0.76744186 0.038647343 0.766956867 0 0 25CD8+ T cell

cured OAS2 0.333 0.053 1 0.052631579 0.925999419 0 0 41Megakaryocyte progenitor cell

cured OASL 0.492 0.118 0.707692308 0.131147541 0.594260934 1.52E-12 2.67E-08 26CD8+ T cell

cured PLSCR1 0.516 0.054 0.709677419 0.063348416 0.685109757 2.02E-09 3.54E-05 28CD8+ T cell

cured PLSCR1 0.755 0.311 1.427672956 0.397727273 0.796491195 3.23E-34 5.68E-30 22CD1C-CD141- dendritic cell

cured PLSCR1 0.667 0.013 0.666666667 0.026315789 0.699490889 0 0 41Megakaryocyte progenitor cell

cured TRIM22 0.667 0.314 1.098039216 0.393225331 0.590613035 2.77E-09 4.86E-05 19CD4+ cytotoxic T cell

cured TRIM22 0.765 0.094 0.823529412 0.094339623 0.736672929 0 0 43AXL+SIGLEC6+ dendritic cell

cured XAF1 0.516 0.19 0.935483871 0.212669683 0.674507654 1.26E-11 2.21E-07 28CD8+ T cell

cured XAF1 0.577 0.184 1.028169014 0.205673759 0.750338298 6.00E-14 1.05E-09 30CD141+CLEC9A+ dendritic cell

cured XAF1 0.353 0.114 0.869767442 0.200431034 0.639306319 8.69E-16 1.53E-11 20CD1C+_B dendritic cell

cured XAF1 0.648 0.298 1.081761006 0.340909091 0.634593021 3.08E-32 5.40E-28 22CD1C-CD141- dendritic cell

cured XAF1 0.5 0.294 1 0.294117647 0.628031223 0 0 45CD1C-CD141- dendritic cell

Table S8 The differential expression of MAPK signal genes in each cell (sub)types of COVID-19 patients with normals

Disease

conditionSymbol pct.1 pct.2 case_Mean_UMI_Countscontrol_Mean_UMI_CountsLog2_Fold_ChangePvalue AdjustPvalue ClusterCell (sub)type

critical DUSP1 0.961 0.393 4.87254902 0.715360139 1.77547535 0 0 1CD4+ T cell

critical DDIT4 0.903 0.105 3.161290323 0.193473193 1.801864783 2.68E-24 4.65E-20 22CD1C-CD141- dendritic cell

critical DDIT4 0.734 0.138 2.560229446 0.27954779 1.476336189 2.69E-128 4.67E-124 8CD1C+_B dendritic cell

critical DUSP1 0.929 0.651 5.5 1.349056604 1.468358241 1.70E-09 2.94E-05 39CD4+ T cell

critical DUSP1 1 0.549 6 1.15037594 1.702766021 3.20E-10 5.55E-06 31CD8+ T cell

critical DUSP1 0.838 0.264 5.459459459 0.67816092 1.944532379 2.50E-11 4.33E-07 33CD1C-CD141- dendritic cell


critical DUSP1 0.85 0.626 3.29 1.538654934 0.756913337 9.15E-14 1.59E-09 5CD4+ cytotoxic T cell

critical DUSP1 1 0.614 4.244897959 1.6069869 1.008531372 8.91E-14 1.54E-09 20CD4+ T helper




critical DUSP1 0.941 0.552 4.8 1.586894587 1.164831633 5.58E-24 9.67E-20 11Megakaryocyte progenitor cell


critical DUSP1 0.971 0.57 6.557971014 1.915621437 1.374195573 3.67E-49 6.37E-45 13CD4+ T helper



critical DUSP1 0.987 0.326 7.562913907 1.47819063 1.788814652 1.71E-64 2.96E-60 16B cell


critical DUSP1 0.993 0.471 7.995024876 2.106164384 1.53399309 3.06E-127 5.30E-123 10B cell

critical DUSP1 0.993 0.449 8.109339408 1.99702381 1.603815891 1.12E-148 1.94E-144 9Effector CD8+ memory T (Tem) cell

critical FOS 0.98 0.57 3.408163265 1.681222707 0.717286601 6.59E-10 1.14E-05 20CD4+ T helper

critical FOS 0.918 0.477 3.623529412 1.582146249 0.840423851 1.89E-16 3.28E-12 11Megakaryocyte progenitor cell

critical FOS 0.826 0.441 4.731884058 2.462941847 0.727011267 8.50E-17 1.47E-12 13CD4+ T helper



critical FOS 0.735 0.179 3.377483444 0.647819063 1.409543885 9.27E-37 1.61E-32 16B cell

critical FOS 0.902 0.667 7.694230769 4.464770932 0.669897366 6.16E-39 1.07E-34 2CD4+ cytotoxic T cell

critical FOS 0.841 0.337 3.801587302 0.866621067 1.363082325 3.88E-40 6.73E-36 6CD4+ T cell

critical FOS 0.898 0.377 5.02238806 1.976027397 1.016947865 2.52E-74 4.36E-70 10B cell

critical FOS 0.902 0.355 4.924829157 1.854166667 1.053703972 1.66E-89 2.88E-85 9Effector CD8+ memory T (Tem) cell

critical FOS 0.824 0.281 3.225490196 0.4741105 1.519274043 1.09E-269 1.89E-265 1CD4+ T cell

critical IER2 0.613 0.51 3.735849057 1.549668874 0.893313203 8.82E-11 1.53E-06 25CD4+ cytotoxic T cell

critical IER2 0.507 0.777 0.993055556 3.05890139 -1.026107365 5.16E-37 8.94E-33 4CD8+ T cell

critical IER2 0.414 0.646 0.665898618 1.602046617 -0.643346205 1.71E-60 2.96E-56 3CD4+ T cell

critical JUN 0.923 0.695 8.292307692 3.110456554 1.176738281 5.74E-13 9.94E-09 17CD4+ T cell

critical JUN 0.361 0.51 1.124282983 2.829393628 -0.850139999 3.60E-18 6.24E-14 8CD1C+_B dendritic cell

critical JUN 0.83 0.699 5.677083333 9.701522171 -0.680526067 1.99E-19 3.45E-15 4CD8+ T cell

critical JUN 0.942 0.648 7.652173913 3.374002281 0.984108692 6.22E-20 1.08E-15 13CD4+ T helper

critical JUN 0.941 0.64 7.352941176 3.195024876 0.993604913 5.96E-23 1.03E-18 12Megakaryocyte progenitor cell


critical JUN 0.939 0.4 5.605263158 1.630390144 1.328339242 8.13E-30 1.41E-25 18Megakaryocyte progenitor cell

critical JUN 0.94 0.404 5.947019868 1.765751212 1.328722836 2.14E-40 3.71E-36 16B cell

critical JUN 0.94 0.767 9.490384615 5.219273302 0.754249651 1.68E-43 2.92E-39 2CD4+ cytotoxic T cell

critical JUN 0.809 0.669 1.6171875 3.708563536 -0.847269712 4.28E-46 7.41E-42 15CD1C+_B dendritic cell

critical JUN 0.973 0.55 7.957711443 3.207762557 1.090076897 7.44E-77 1.29E-72 10B cell

critical JUN 0.97 0.533 7.876993166 3.084325397 1.119973277 7.57E-90 1.31E-85 9Effector CD8+ memory T (Tem) cell


critical JUNB 0.748 0.577 2.728476821 1.381260097 0.646861163 1.97E-09 3.41E-05 16B cell

critical JUNB 0.75 0.644 0.75 1.815068493 -0.685815103 0 0 30Plasmacytoid dendritic cell

critical JUND 0.622 0.057 2.72972973 0.287356322 1.534659665 8.26E-10 1.43E-05 33CD1C-CD141- dendritic cell

critical NR4A1 0.161 0.566 0.161290323 1.104895105 -0.858019649 0 0 22CD1C-CD141- dendritic cell

server ATF3 0.598 0.209 1.149466192 0.351633987 0.669273886 4.71E-31 8.31E-27 15CD1C+_B dendritic cell

server ATF3 0.699 0.309 1.576923077 0.365426696 0.916297609 1.49E-48 2.63E-44 21CD1C-CD141- dendritic cell

server ATF3 0.786 0.384 1.63 0.577850877 0.737101937 2.81E-62 4.96E-58 9CD1C+_B dendritic cell

server DDIT4 0.389 0.189 1.166666667 0.295857988 0.741569594 3.67E-11 6.47E-07 26 T cell

server DDIT4 0.116 0.395 0.115942029 0.713178295 -0.61841322 0 0 35Effector CD8+ memory T (Tem) cell

server DUSP1 0.8 0.592 3.188888889 1.467455621 0.76354348 4.84E-09 8.54E-05 26 T cell

server DUSP1 0.809 0.605 4.221276596 2.150819672 0.728675399 1.17E-13 2.06E-09 17CD4+ T cell


server DUSP1 0.78 0.548 3.292682927 1.555973659 0.748006645 2.01E-17 3.54E-13 12Megakaryocyte progenitor cell

server DUSP1 1 0.814 8.658291457 3.946902655 0.96524249 6.53E-18 1.15E-13 30CD1C-CD141- dendritic cell

server DUSP1 0.914 0.277 5.8 0.710843373 1.990827058 1.79E-18 3.16E-14 38Plasmacytoid dendritic cell



server DUSP1 0.994 0.631 3.987692308 1.68875502 0.891434154 5.84E-52 1.03E-47 18CD4+ T helper

server DUSP1 0.925 0.332 7.52173913 1.528846154 1.752668617 6.59E-54 1.16E-49 19CD141+CLEC9A+ dendritic cell


server DUSP1 0.579 0.597 1.614035088 4.637313433 -1.108729277 8.38E-66 1.48E-61 5Effector CD8+ memory T (Tem) cell




server DUSP1 0.978 0.47 8.824657534 2.081986143 1.672546744 9.18E-119 1.62E-114 13CD141+CLEC9A+ dendritic cell

server DUSP1 0.698 0.366 1.881998277 0.645919779 0.808175452 1.53E-132 2.69E-128 1Naive CD4+ T cell

server DUSP2 0.45 0.782 0.8625 4.229480737 -1.489427275 1.22E-16 2.16E-12 20CD141+CLEC9A+ dendritic cell

server DUSP2 0.211 0.578 0.330827068 2.358381503 -1.335443011 8.79E-18 1.55E-13 31CD8 cytoxict cells

server DUSP2 0.533 0.154 1.033333333 0.183431953 0.780869988 1.04E-18 1.83E-14 26 T cell

server DUSP2 0.349 0.651 0.712871287 2.609501738 -1.075382954 3.34E-43 5.90E-39 10CD8+ T cell

server DUSP2 0.067 0.306 0.082934609 1.155970149 -0.993391072 5.72E-55 1.01E-50 5Effector CD8+ memory T (Tem) cell


server FOS 0.77 0.493 4.072340426 2.367213115 0.59109654 5.17E-13 9.13E-09 17CD4+ T cell

server FOS 0.785 0.471 3.136585366 1.523047977 0.713272715 4.19E-17 7.39E-13 12Megakaryocyte progenitor cell

server FOS 1 0.77 26.2160804 13.85840708 0.873179851 1.93E-19 3.40E-15 30CD1C-CD141- dendritic cell

server FOS 0.957 0.253 8.171428571 1.204819277 2.056486063 2.39E-21 4.22E-17 38Plasmacytoid dendritic cell



server FOS 0.987 0.761 36.00641026 16.56236324 1.075288205 1.68E-35 2.96E-31 21CD1C-CD141- dendritic cell

server FOS 0.739 0.184 3.068322981 0.671474359 1.283312995 4.17E-38 7.36E-34 19CD141+CLEC9A+ dendritic cell


server FOS 0.585 0.516 1.435406699 3.424626866 -0.861393082 7.70E-60 1.36E-55 5Effector CD8+ memory T (Tem) cell


server FOS 0.991 0.59 6.046153846 1.773092369 1.345340303 8.22E-68 1.45E-63 18CD4+ T helper

server FOS 0.932 0.375 8.120547945 1.974595843 1.616426838 1.58E-91 2.79E-87 13CD141+CLEC9A+ dendritic cell

server FOS 0.649 0.265 1.514211886 0.424965422 0.819179327 9.02E-149 1.59E-144 1Naive CD4+ T cell

server FOS 0.2 0.033 1.511111111 0.032786885 1.28178328 0 0 43Plasmacytoid dendritic cell

server FOSB 0.628 0.234 1.358974359 0.332603939 0.823911674 8.22E-26 1.45E-21 21CD1C-CD141- dendritic cell

server FOSB 0.884 0.511 2.322 0.921052632 0.790155028 1.02E-68 1.81E-64 9CD1C+_B dendritic cell

server FOSB 0.314 0.036 0.842857143 0.072289157 0.781250239 0 0 38Plasmacytoid dendritic cell

server IER2 0.9 0.289 1.771428571 0.614457831 0.779580066 2.70E-15 4.76E-11 38Plasmacytoid dendritic cell

server IER2 0.857 0.289 3.142857143 0.377777778 1.588282859 5.58E-16 9.84E-12 41Naive CD8+ T cell

server IER2 0.733 0.363 3 0.593137255 1.328129434 7.23E-17 1.28E-12 32Naive CD8+ T cell

server IER2 0.928 0.374 2.652173913 0.969387755 0.891008274 3.00E-17 5.30E-13 28CD1C+_B dendritic cell

server IER2 0.897 0.742 5.269230769 2.312910284 0.920189301 2.18E-17 3.85E-13 21CD1C-CD141- dendritic cell

server IER2 0.96 0.522 3.447236181 1.716814159 0.710993141 1.08E-20 1.90E-16 30CD1C-CD141- dendritic cell


server IER2 0.803 0.4 3.074468085 0.797183099 1.180874331 1.06E-30 1.87E-26 23CD4+ T cell


server IER2 0.822 0.37 3.322222222 0.547337278 1.481985549 1.96E-41 3.45E-37 26 T cell

server IER2 0.922 0.179 1.430167598 0.271794872 0.934189817 8.04E-51 1.42E-46 27Megakaryocyte progenitor cell





server IER2 0.652 0.76 1.108452951 2.752238806 -0.83156682 4.63E-78 8.18E-74 5Effector CD8+ memory T (Tem) cell


server IER2 0.982 0.289 2.996923077 0.803212851 1.148320105 3.76E-111 6.64E-107 18CD4+ T helper



server IER2 0.771 0.321 2.612403101 0.459543568 1.307441612 0 0 1Naive CD4+ T cell

server JUN 1 0.543 9.108108108 2.1 1.705172879 5.34E-13 9.42E-09 37CD8+ T cell

server JUN 0.986 0.823 6.202898551 2.411564626 1.078144039 7.80E-14 1.38E-09 28CD1C+_B dendritic cell

server JUN 1 0.559 8.702702703 1.934210526 1.725414282 7.32E-16 1.29E-11 36CD8+ T cell

server JUN 1 0.544 8.428571429 1.577777778 1.870911299 5.03E-16 8.88E-12 41Naive CD8+ T cell

server JUN 0.978 0.471 6.733333333 1.382352941 1.698703238 1.39E-19 2.46E-15 32Naive CD8+ T cell

server JUN 1 0.386 10.5 1.373493976 2.276549568 1.37E-23 2.43E-19 38Plasmacytoid dendritic cell

server JUN 1 0.752 11.89447236 3.008849558 1.685492557 3.36E-24 5.93E-20 30CD1C-CD141- dendritic cell


server JUN 0.933 0.689 12.35555556 2.74260355 1.835325851 6.84E-36 1.21E-31 26 T cell

server JUN 0.955 0.764 2.446927374 0.984615385 0.796451459 4.93E-41 8.70E-37 27Megakaryocyte progenitor cell

server JUN 0.968 0.645 12.80319149 3.408450704 1.646658244 2.67E-43 4.70E-39 23CD4+ T cell

server JUN 0.833 0.214 5.448717949 0.822757112 1.822890041 1.39E-46 2.46E-42 21CD1C-CD141- dendritic cell


server JUN 0.64 0.625 2.397129187 7.558208955 -1.332992822 4.86E-58 8.58E-54 5Effector CD8+ memory T (Tem) cell

server JUN 0.938 0.402 10.40993789 1.761217949 2.046914266 4.35E-59 7.67E-55 19CD141+CLEC9A+ dendritic cell


server JUN 0.997 0.606 7.590769231 2.604417671 1.253021122 4.83E-69 8.51E-65 18CD4+ T helper




server JUN 0.989 0.554 15.22739726 3.236720554 1.937411743 2.65E-119 4.68E-115 13CD141+CLEC9A+ dendritic cell




server JUN 0.96 0.547 8.274763135 1.523858921 1.877679169 0 0 1Naive CD4+ T cell

server JUNB 0.946 0.671 7.486486486 2.185714286 1.4135505 7.47E-11 1.32E-06 37CD8+ T cell

server JUNB 0.971 0.789 10.11428571 2.944444444 1.49452121 7.31E-12 1.29E-07 41Naive CD8+ T cell

server JUNB 0.978 0.711 8.4 2.607843137 1.381524143 5.59E-13 9.86E-09 32Naive CD8+ T cell

server JUNB 0.986 0.844 7.405797101 2.785714286 1.150819101 4.01E-13 7.08E-09 28CD1C+_B dendritic cell


server JUNB 1 0.788 4.381909548 2.309734513 0.701402647 1.21E-14 2.13E-10 30CD1C-CD141- dendritic cell

server JUNB 0.971 0.373 3.271428571 0.927710843 1.147829994 4.06E-16 7.16E-12 38Plasmacytoid dendritic cell

server JUNB 0.989 0.793 10.76666667 3.920118343 1.257940761 1.17E-22 2.07E-18 26 T cell


server JUNB 0.839 0.579 4.322981366 1.389423077 1.155572193 1.65E-30 2.92E-26 19CD141+CLEC9A+ dendritic cell

server JUNB 0.95 0.8 2.184357542 1.025641026 0.652623802 2.31E-31 4.08E-27 27Megakaryocyte progenitor cell



server JUNB 0.989 0.796 5.444839858 2.671895425 0.811619539 8.51E-45 1.50E-40 15CD1C+_B dendritic cell

server JUNB 0.451 0.641 0.728867624 1.744776119 -0.666861071 5.13E-45 9.04E-41 5Effector CD8+ memory T (Tem) cell


server JUNB 0.994 0.653 4.836923077 1.977911647 0.970907105 2.68E-54 4.73E-50 18CD4+ T helper



server JUNB 1 0.897 7.906 4.483552632 0.699666736 6.68E-74 1.18E-69 9CD1C+_B dendritic cell

server JUNB 0.838 0.508 3.857534247 1.065819861 1.23350971 2.14E-78 3.78E-74 13CD141+CLEC9A+ dendritic cell



server JUNB 0.957 0.713 8.786391042 2.404910097 1.523160225 0 0 1Naive CD4+ T cell

server JUNB 0.378 0.049 1.288888889 0.049180328 1.125384768 0 0 43Plasmacytoid dendritic cell

server JUND 0.744 0.422 1.583333333 0.58643326 0.70344698 1.40E-24 2.48E-20 21CD1C-CD141- dendritic cell

server NR4A1 0.308 0.547 0.365384615 1.059080963 -0.592693156 9.38E-16 1.66E-11 21CD1C-CD141- dendritic cell

moderate DUSP1 0.784 0.568 2.637889688 1.013513514 0.853386642 1.32E-09 2.45E-05 41CD8+ T cell


moderate DUSP1 0.912 0.276 2.725490196 0.671052632 1.156673093 2.63E-24 4.90E-20 47Plasmacytoid dendritic cell

moderate DUSP1 0.599 0.571 1.991635688 3.552208835 -0.605632245 5.81E-50 1.08E-45 12Plasmacytoid dendritic cell


moderate DUSP1 0.833 0.415 3.85137881 1.843317972 0.770819387 5.87E-185 1.09E-180 5CD141+CLEC9A+ dendritic cell

moderate DUSP2 0.445 0.579 0.937304075 2.530054645 -0.865640102 6.49E-19 1.21E-14 37CD8+ T cell

moderate DUSP2 0.508 0.72 1.203108808 3.334285714 -0.976253509 1.70E-38 3.17E-34 27Effector CD8+ memory T (Tem) cell

moderate DUSP2 0.425 0.643 0.971428571 2.512735327 -0.833353438 1.09E-62 2.03E-58 13CD8+ T cell

moderate DUSP2 0.49 0.74 1.182356814 3.955729167 -1.183210345 5.53E-64 1.03E-59 22CD1C-CD141- dendritic cell

moderate DUSP2 0.296 0.451 0.526618705 1.55942623 -0.745480651 6.51E-67 1.21E-62 16Effector CD8+ memory T (Tem) cell

moderate FOS 0.5 0.339 1.671328671 0.779661017 0.585955023 6.28E-11 1.17E-06 42CD8+ T cell

moderate FOS 0.98 0.891 11.75820569 5.512605042 0.970118801 5.49E-11 1.02E-06 33CD1C+_B dendritic cell




moderate FOS 0.887 0.224 4.710784314 1.25 1.343763896 9.58E-25 1.78E-20 47Plasmacytoid dendritic cell



moderate FOS 0.875 0.577 3.847527473 1.91002045 0.736219783 8.31E-45 1.55E-40 21T cell (Activated T cell)

moderate FOS 0.62 0.303 2.893759071 1.421329822 0.685364009 1.40E-94 2.61E-90 5CD141+CLEC9A+ dendritic cell



moderate FOSB 0.279 0.039 0.62745098 0.078947368 0.592989598 0 0 47Plasmacytoid dendritic cell

moderate IER2 0.618 0.347 1.345549738 0.466101695 0.677940916 7.64E-11 1.42E-06 46CD8+ T cell



moderate IER2 0.675 0.394 1.772663877 0.717592593 0.690884858 5.00E-17 9.31E-13 36T cell


moderate IER2 0.882 0.316 2.450980392 0.644736842 1.069149505 4.34E-21 8.08E-17 47Plasmacytoid dendritic cell

moderate IER2 0.65 0.413 1.986754967 0.815249267 0.718411214 2.92E-22 5.43E-18 24Naive CD8+ T cell

moderate IER2 0.903 0.482 2.889959839 1.547445255 0.610704117 1.75E-30 3.25E-26 26CD1C-CD141- dendritic cell

moderate IER2 0.784 0.265 1.187366167 0.441176471 0.601947746 4.38E-33 8.15E-29 20Megakaryocyte progenitor cell








moderate IER2 0.847 0.321 1.986263736 0.901840491 0.650945334 7.99E-107 1.49E-102 21T cell (Activated T cell)

moderate IER2 0.707 0.501 2.102363867 0.98343887 0.645363972 1.06E-116 1.98E-112 2Activated CD4+ T cell


moderate IER2 0.576 0.413 1.964296081 0.658986175 0.837387691 2.58E-147 4.80E-143 5CD141+CLEC9A+ dendritic cell



moderate IER2 0.696 0.286 2.027467811 0.285714286 1.235541541 0 0 29CD141+CLEC9A+ dendritic cell

moderate JUN 0.855 0.592 4.6171875 1.653061224 1.082189992 6.58E-13 1.22E-08 45CD8+ T cell





moderate JUN 0.964 0.883 15.10269914 9.697916667 0.589972663 1.19E-17 2.21E-13 22CD1C-CD141- dendritic cell

moderate JUN 0.923 0.786 12.36476684 5.891428571 0.955559683 2.06E-24 3.83E-20 27Effector CD8+ memory T (Tem) cell

moderate JUN 0.496 0.176 1.943238731 0.658291457 0.827706973 8.04E-25 1.49E-20 34CD1C-CD141- dendritic cell


moderate JUN 0.961 0.342 4.200980392 1.381578947 1.126865225 5.09E-26 9.46E-22 47Plasmacytoid dendritic cell


moderate JUN 0.741 0.745 5.624940048 10.40983607 -0.784298759 2.84E-32 5.29E-28 16Effector CD8+ memory T (Tem) cell

moderate JUN 0.805 0.621 5.414459556 2.985781991 0.686464916 6.13E-34 1.14E-29 19Effector CD8+ memory T (Tem) cell


moderate JUN 0.934 0.611 4.521978022 2.617586912 0.610157468 2.17E-60 4.04E-56 21T cell (Activated T cell)

moderate JUN 0.847 0.494 5.511465893 2.614878209 0.849035325 8.03E-148 1.49E-143 5CD141+CLEC9A+ dendritic cell



moderate JUNB 0.906 0.644 5.408376963 2.076271186 1.058776326 1.50E-12 2.79E-08 46CD8+ T cell





moderate JUNB 0.971 0.382 2.985294118 0.855263158 1.103062361 1.32E-26 2.46E-22 47Plasmacytoid dendritic cell

moderate JUNB 0.964 0.781 4.444367177 2.520775623 0.62887108 3.92E-73 7.30E-69 8CD1C+_B dendritic cell


moderate JUNB 0.837 0.538 3.627285922 1.202106649 1.071281905 2.15E-200 4.01E-196 5CD141+CLEC9A+ dendritic cell


moderate JUNB 0.434 0.083 1.518072289 0.083333333 1.216842483 0 0 49AXL+SIGLEC6+ dendritic cell

moderate JUND 0.218 0.427 0.289208633 1.091188525 -0.697837375 5.47E-108 1.02E-103 16Effector CD8+ memory T (Tem) cell

cured ATF3 0.01 0.364 0.009868421 0.555371901 -0.623092249 0 0 9CD1C+_B dendritic cell

cured DDIT4 0.667 0.211 1.333333333 0.289473684 0.855610091 0 0 41Megakaryocyte progenitor cell

cured DDIT4 0.775 0.422 3.07266436 0.789800995 1.186173737 2.63E-178 4.62E-174 2Effector CD8+ memory T (Tem) cell



cured DDIT4 0.677 0.184 1.8 0.229508197 1.187345474 5.53E-25 9.70E-21 26CD8+ T cell


cured DDIT4 0.725 0.243 2.019607843 0.431516937 1.076816459 3.30E-14 5.79E-10 19CD4+ cytotoxic T cell

cured DDIT4 0.651 0.372 2.093023256 0.623188406 0.930187216 4.54E-11 7.97E-07 25CD8+ T cell

cured DDIT4 0.099 0.44 0.126760563 1.843971631 -1.335726099 7.12E-10 1.25E-05 30CD141+CLEC9A+ dendritic cell

cured DUSP1 0.039 0.58 0.039473684 1.969870875 -1.514546972 0 0 15CD4+ T cell






cured DUSP1 0.167 0.939 0.166666667 3.017391304 -1.783866569 0 0 38CD1C+_B dendritic cell

cured DUSP1 0.38 0.791 0.574013158 8.236363636 -2.552877372 4.38E-274 7.70E-270 9CD1C+_B dendritic cell

cured DUSP1 0.176 0.844 0.232594937 4.03698075 -2.030860447 2.06E-270 3.61E-266 4CD4+ T cell

cured DUSP1 0.072 0.58 0.083910035 2.430970149 -1.662371557 1.86E-236 3.27E-232 2Effector CD8+ memory T (Tem) cell


cured DUSP1 0.084 0.622 0.092911877 1.411974341 -1.14203748 1.02E-215 1.79E-211 5Naive CD8+ T cell


cured DUSP1 0.087 0.458 0.093718843 2.046153846 -1.477746887 4.89E-155 8.58E-151 8CD141+CLEC9A+ dendritic cell

cured DUSP1 0.058 0.346 0.059032717 0.59 -0.586279606 5.79E-155 1.02E-150 1Naive CD8+ T cell



cured DUSP1 0.042 0.635 0.091334895 1.665338645 -1.288224962 1.15E-93 2.01E-89 17T cell (Activated T cell)


cured DUSP1 0.074 0.752 0.134883721 4.943965517 -2.388881258 2.43E-76 4.27E-72 20CD1C+_B dendritic cell

cured DUSP1 0.115 0.703 0.141025641 2.590909091 -1.654017917 3.01E-67 5.29E-63 18Memory B cell



cured DUSP1 0.843 0.923 2.132075472 8.259090909 -1.563751575 9.33E-46 1.64E-41 22CD1C-CD141- dendritic cell


cured DUSP1 0.216 0.949 0.31372549 9.563139932 -3.007302991 1.80E-44 3.17E-40 21Plasmacytoid dendritic cell

cured DUSP1 0.078 0.608 0.1015625 1.565340909 -1.219599206 2.04E-29 3.58E-25 24T cell

cured DUSP1 0.031 0.904 0.03125 1.170603675 -1.073702212 2.81E-27 4.93E-23 13Megakaryocyte progenitor cell

cured DUSP1 0.073 0.548 0.083333333 1.59800995 -1.261929739 1.80E-23 3.17E-19 14Megakaryocyte progenitor cell



cured DUSP1 0.078 0.722 0.117647059 2.309278351 -1.566051973 3.47E-20 6.09E-16 19CD4+ cytotoxic T cell


cured DUSP1 0.321 0.824 0.703703704 3.925925926 -1.531720479 3.01E-16 5.28E-12 34CD1C-CD141- dendritic cell


cured DUSP2 0.056 0.298 0.056338028 0.872340426 -0.825771196 0 0 30CD141+CLEC9A+ dendritic cell


cured FOS 0.004 0.42 0.003601441 0.891741071 -0.914528189 0 0 3Effector CD8+ memory T (Tem) cell

cured FOS 0.008 0.428 0.007662835 0.962223806 -0.961476608 0 0 5Naive CD8+ T cell

cured FOS 0.002 0.368 0.001994018 1.940512821 -1.553193885 0 0 8CD141+CLEC9A+ dendritic cell

cured FOS 0.005 0.436 0.005012531 2.34687157 -1.735599701 0 0 11CD4+ T cell

cured FOS 0.01 0.469 0.009868421 2.195121951 -1.661703665 0 0 15CD4+ T cell

cured FOS 0.005 0.588 0.009367681 1.733067729 -1.437069413 0 0 17T cell (Activated T cell)

cured FOS 0.009 0.477 0.008547009 1.914772727 -1.531105067 0 0 18Memory B cell

cured FOS 0.024 0.57 0.023809524 4.900826446 -2.526969695 0 0 32Effector CD8+ memory T (Tem) cell

cured FOS 0.025 0.772 0.03164557 6.032928065 -2.769178055 6.49E-285 1.14E-280 4CD4+ T cell

cured FOS 0.439 0.819 1.123355263 30.23719008 -3.878847006 3.98E-281 6.98E-277 9CD1C+_B dendritic cell

cured FOS 0.01 0.567 0.012484395 4.340014316 -2.398943938 6.82E-197 1.20E-192 6Effector CD8+ memory T (Tem) cell

cured FOS 0.008 0.318 0.008650519 1.044154229 -1.019077659 4.07E-126 7.14E-122 2Effector CD8+ memory T (Tem) cell

cured FOS 0.177 0.774 0.362790698 24.99568966 -4.25363652 1.66E-98 2.91E-94 20CD1C+_B dendritic cell

cured FOS 0 0.553 0 2.718787879 -1.894832458 1.88E-95 3.31E-91 12CD8+ T cell


cured FOS 0.164 0.759 0.371069182 16.37954545 -3.664017076 2.30E-56 4.04E-52 22CD1C-CD141- dendritic cell


cured FOS 0.039 0.875 0.176470588 10.41808874 -3.278784021 1.09E-35 1.92E-31 21Plasmacytoid dendritic cell

cured FOS 0 0.53 0 1.654036244 -1.408188072 8.13E-34 1.43E-29 10Effector CD8+ memory T (Tem) cell

cured FOS 0 0.903 0 1.631671041 -1.395979163 1.64E-30 2.88E-26 13Megakaryocyte progenitor cell

cured FOS 0 0.479 0 1.583084577 -1.369094882 2.90E-25 5.10E-21 14Megakaryocyte progenitor cell

cured FOS 0 0.409 0 1.278409091 -1.188026808 1.02E-23 1.79E-19 24T cell

cured FOS 0.606 0.816 2 20.91489362 -2.86887727 2.42E-23 4.24E-19 30CD141+CLEC9A+ dendritic cell

cured FOS 0.481 0.778 1.962962963 14.05555556 -2.345183447 1.74E-14 3.05E-10 34CD1C-CD141- dendritic cell


cured FOS 0 0.372 0 1.823170732 -1.497316379 1.75E-13 3.08E-09 27CD8+ T cell

cured FOS 0 0.965 0 5.756521739 -2.756280737 2.87E-13 5.04E-09 38CD1C+_B dendritic cell

cured FOS 0.02 0.443 0.274509804 1.312223859 -0.859338608 1.03E-11 1.81E-07 19CD4+ cytotoxic T cell

cured FOSB 0.01 0.527 0.011513158 1.010743802 -0.991214186 2.72E-136 4.77E-132 9CD1C+_B dendritic cell

cured FOSB 0 0.336 0 0.831896552 -0.873338036 5.08E-30 8.91E-26 20CD1C+_B dendritic cell

cured FOSB 0.012 0.454 0.012345679 1.740740741 -1.436863862 3.82E-13 6.70E-09 34CD1C-CD141- dendritic cell

cured IER2 0.452 0.748 0.699013158 2.890082645 -1.19510378 1.70E-105 2.98E-101 9CD1C+_B dendritic cell

cured IER2 0.739 0.785 1.515605493 3.023622047 -0.677589103 8.93E-69 1.57E-64 6Effector CD8+ memory T (Tem) cell

cured IER2 0.372 0.64 0.613953488 2.747844828 -1.215462219 3.34E-31 5.86E-27 20CD1C+_B dendritic cell

cured IER2 0.572 0.748 0.874213836 2.331818182 -0.830024109 7.34E-22 1.29E-17 22CD1C-CD141- dendritic cell

cured IER2 0.437 0.66 0.492957746 1.737588652 -0.87473235 6.24E-17 1.10E-12 30CD141+CLEC9A+ dendritic cell

cured JUN 0.017 0.523 0.017069701 1.408518519 -1.243727464 0 0 1Naive CD8+ T cell

cured JUN 0.04 0.76 0.041187739 3.472558803 -2.102870222 0 0 5Naive CD8+ T cell

cured JUN 0.046 0.497 0.046464646 1.851875809 -1.446387585 0 0 7CD8+ T cell


cured JUN 0.009 0.707 0.018604651 3.700431034 -2.20619885 0 0 20CD1C+_B dendritic cell

cured JUN 0.013 0.198 0.012578616 0.797727273 -0.828140248 0 0 22CD1C-CD141- dendritic cell

cured JUN 0.023 0.693 0.0234375 2.556818182 -1.797164227 0 0 24T cell




cured JUN 0.025 0.759 0.049382716 3.009259259 -1.933794779 0 0 34CD1C-CD141- dendritic cell



cured JUN 0.041 0.777 0.047468354 5.641843972 -2.664677173 4.93E-282 8.65E-278 4CD4+ T cell

cured JUN 0.185 0.671 0.225967541 9.665712241 -3.120987623 9.34E-237 1.64E-232 6Effector CD8+ memory T (Tem) cell



cured JUN 0.2 0.539 0.25224327 3.131282051 -1.722074701 2.80E-167 4.92E-163 8CD141+CLEC9A+ dendritic cell


cured JUN 0.038 0.534 0.039473684 3.09338843 -1.977442339 7.55E-138 1.33E-133 9CD1C+_B dendritic cell


cured JUN 0.021 0.61 0.035128806 2.414342629 -1.72179754 5.95E-96 1.05E-91 17T cell (Activated T cell)

cured JUN 0.034 0.693 0.047008547 4.365530303 -2.357447548 6.95E-77 1.22E-72 18Memory B cell


cured JUN 0.217 0.396 0.292110874 1.628571429 -1.024549068 6.72E-42 1.18E-37 16CD141+CLEC9A+ dendritic cell


cured JUN 0.042 0.67 0.0625 2.795024876 -1.836646501 5.17E-36 9.08E-32 14Megakaryocyte progenitor cell

cured JUN 0.137 0.87 0.156862745 8.313993174 -3.009182117 1.16E-33 2.04E-29 21Plasmacytoid dendritic cell

cured JUN 0 0.906 0 1.170603675 -1.118096332 7.65E-31 1.34E-26 13Megakaryocyte progenitor cell



cured JUN 0 0.974 0 3.330434783 -2.114511881 6.61E-14 1.16E-09 38CD1C+_B dendritic cell


cured JUN 0.118 0.595 0.176470588 2.17820324 -1.433746132 7.37E-12 1.29E-07 19CD4+ cytotoxic T cell



cured JUNB 0.583 0.939 0.583333333 2.539130435 -1.160429921 0 0 38CD1C+_B dendritic cell

cured JUNB 0.414 0.837 0.569923372 4.397719173 -1.7816557776.0271450351466e-309 1.06E-304 5Naive CD8+ T cell

cured JUNB 0.345 0.704 0.421052632 2.254074074 -1.195287103 1.07E-304 1.87E-300 1Naive CD8+ T cell

cured JUNB 0.519 0.886 0.743670886 7.958966565 -2.361204564 3.26E-286 5.71E-282 4CD4+ T cell




cured JUNB 0.676 0.885 1.345394737 4.112396694 -1.124169033 7.30E-106 1.28E-101 9CD1C+_B dendritic cell


cured JUNB 0.444 0.658 0.644194757 1.947029349 -0.84188023 4.15E-93 7.29E-89 6Effector CD8+ memory T (Tem) cell

cured JUNB 0.543 0.847 0.799145299 6.84280303 -2.124057665 6.84E-89 1.20E-84 18Memory B cell


cured JUNB 0.173 0.659 0.37470726 2 -1.125838067 2.05E-71 3.61E-67 17T cell (Activated T cell)

cured JUNB 0.205 0.761 0.493023256 2.278017241 -1.134586805 5.83E-46 1.02E-41 20CD1C+_B dendritic cell

cured JUNB 0.453 0.798 0.5859375 3.900568182 -1.627613111 2.52E-41 4.42E-37 24T cell

cured JUNB 0.427 0.775 0.541666667 3.995024876 -1.696000998 8.47E-35 1.49E-30 14Megakaryocyte progenitor cell

cured JUNB 0.094 0.92 0.21875 1.185476815 -0.842545855 2.08E-27 3.66E-23 13Megakaryocyte progenitor cell

cured JUNB 0.49 0.874 0.68627451 4.76109215 -1.772502922 2.30E-22 4.04E-18 21Plasmacytoid dendritic cell



cured JUNB 0.412 0.652 0.450980392 1.71281296 -0.902761558 2.99E-12 5.24E-08 19CD4+ cytotoxic T cell

cured JUNB 0.925 0.973 3.798742138 6.554545455 -0.654688662 8.41E-12 1.48E-07 22CD1C-CD141- dendritic cell

cured JUNB 0.93 0.901 2.591549296 6.042553191 -0.971492238 6.96E-11 1.22E-06 30CD141+CLEC9A+ dendritic cell



cured JUNB 0.369 0.628 0.547619048 1.842975207 -0.877351127 2.48E-09 4.35E-05 32Effector CD8+ memory T (Tem) cell

cured JUND 0.094 0.4 0.106117353 0.956335004 -0.822648983 6.65E-88 1.17E-83 6Effector CD8+ memory T (Tem) cell

cured JUND 0.102 0.427 0.186046512 1.153017241 -0.860199285 8.54E-21 1.50E-16 20CD1C+_B dendritic cell

cured NR4A1 0.056 0.355 0.056338028 0.680851064 -0.670120326 0 0 30CD141+CLEC9A+ dendritic cell

Table S9 List of the most enriched clone antibodies in each patient by TCR single cell transcriptome analysis.

TRA-CDR3-TRB-CDR3 TRA_v_gene TRA_j_gene TRA_c_geneTRB_v_gene TRB_d_geneTRB_j_gene TRB_c_gene Patient1Patient2Patient3Patient4Patient5Patient6Patient7Patient8Patient9 Patient10

CGTDADNNNDMRF-CASSLTSGRGEQYF TRAV30*01 TRAJ43*01 TRAC*01 TRBV28*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 6 0 0 0 0 0 0 0 0 0

CAVTSGSRLTF-CASSLLPWRELFF TRAV39*01 TRAJ58*01 TRAC*01 TRBV11-2*01 TRBD2*02 TRBJ1-4*01 TRBC1*01 6 0 0 0 0 0 0 0 0 0

CVVNVGNGNKLVF-CASSPPEGGSSYNEQFF TRAV12-1*01 TRAJ47*01 TRAC*01 TRBV5-6*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 5 0 0 0 0 0 0 0 0 0

CALSDADMDTGRRALTF-CASSTEQGARSDTQYF TRAV19*01 TRAJ5*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 5 0 0 0 0 0 0 0 0 0

CALRSGGSYIPTF-CASSSLDSYEQYF TRAV19*01 TRAJ6*01 TRAC*01 TRBV11-3*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 5 0 0 0 0 0 0 0 0 0

CAIDLSSGSARQLTF-CASKGNSYEQYF TRAV14/DV4*01 TRAJ22*01 TRAC*01 TRBV28*01 None TRBJ2-7*01 TRBC2*01 0 0 182 0 0 0 0 0 0 0

CAVRTAGNKLTF-CASSDPVTQYF TRAV1-2*01 TRAJ17*01 TRAC*01 TRBV9*01 None TRBJ2-3*01 TRBC2*02 0 0 143 0 0 0 0 0 0 0

CAVKNAGNMLTF-CASQGPNTEAFF TRAV1-2*01 TRAJ39*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 69 0 0 0 0 0 0 0

CVVNRDFQKLVF-CASRALGVSSGNYGYTF TRAV12-1*01 TRAJ8*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 44 0 0 0 0 0 0 0

CAVLAQANDYKLSF-CASSGNTGGSYEQYF TRAV13-2*01 TRAJ20*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 36 0 0 0 0 0 0 0

CAVKGTYKYIF-CASSVGGTLSSYNEQFF TRAV8-1*01 TRAJ40*01 TRAC*01 TRBV10-2*01 TRBD2*01 TRBJ2-1*01 TRBC2*02 0 0 23 0 0 0 0 0 0 0

CAVRQAGNQFYF-CASSGNTGGSYEQYF TRAV1-2*01 TRAJ49*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ2-7*01 TRBC2*02 0 0 16 0 0 0 0 0 0 0

CAASANNARLMF-CSASVQRENDEQFF TRAV29/DV5*01 TRAJ31*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-1*01 TRBC2*02 0 0 15 0 0 0 0 0 0 0

CAFMGGSARQLTF-CASRERGGNTEAFF TRAV38-1*01 TRAJ22*01 TRAC*01 TRBV19*01 TRBD1*01 TRBJ1-1*01 TRBC2*02 0 0 15 0 0 0 0 0 0 0

CAGPRDLYNQGGKLIF-CAAKTATNEKLFF TRAV27*01 TRAJ23*01 TRAC*01 TRBV5-4*01 None TRBJ1-4*01 None 0 0 12 0 0 0 0 0 0 0

CVVSESGNTPLVF-CASSQDGGFGETQYF TRAV8-2*01 TRAJ29*01 TRAC*01 TRBV3-1*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 12 0 0 0 0 0 0 0

CAGLNGSSNTGKLIF-CASSAHGRNNEQFF TRAV27*01 TRAJ37*02 TRAC*01 TRBV9*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 12 0 0 0 0 0 0 0

CALRDTGFQKLVF-CASSPLLSDSYNEQFF TRAV13-2*01 TRAJ8*01 TRAC*01 TRBV7-7*01 None TRBJ2-1*01 TRBC2*02 0 0 11 0 0 0 0 0 0 0

CLVGHQTGANNLFF-CASSGRAVAGETQYF TRAV4*01 TRAJ36*01 TRAC*01 TRBV10-2*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 11 0 0 0 0 0 0 0

CALSEAYSGGGADGLTF-CAISGTGGTIEQYF TRAV19*01 TRAJ45*01 TRAC*01 TRBV10-3*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 10 0 0 0 0 0 0 0

CAASRTGANNLFF-CASSHEDSRQETQYF TRAV13-1*01 TRAJ36*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 10 0 0 0 0 0 0 0

CAVKDSNYQLIW-CATSNRADGANVLTF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV24-1*01 TRBD1*01 TRBJ2-6*01 TRBC2*02 0 0 9 0 0 0 0 0 0 0

CAERISDGQKLLF-CASSGTGGSGANVLTF TRAV5*01 TRAJ16*01 TRAC*01 TRBV6-6*01 TRBD1*01 TRBJ2-6*01 TRBC2*01 0 0 8 0 0 0 0 0 0 0

CADSGGYNKLIF-CASRLLDRAAEQFF TRAV5*01 TRAJ4*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 8 0 0 0 0 0 0 0

CAVSGRGGYNKLIF-CASSLSTASTDTQYF TRAV12-2*01 TRAJ4*01 TRAC*01 TRBV5-1*01 None TRBJ2-3*01 TRBC2*01 0 0 8 0 0 0 0 0 0 0

CAASLNAGNMLTF-CASSLKDRVTNTEAFF TRAV29/DV5*01 TRAJ39*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 8 0 0 0 0 0 0 0

CAVRDFYQKVTF-CASSFRDRADEQFF TRAV3*01 TRAJ13*02 TRAC*01 TRBV11-1*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 8 0 0 0 0 0 0 0

CAFPRGGSNYKLTF-CSARDTQGAGHYEQYF TRAV24*01 TRAJ53*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 7 0 0 0 0 0 0 0

CAVMDSNYQLIW-CSASHRDYDYNEQFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV20-1*02 TRBD2*01 TRBJ2-1*01 TRBC2*02 0 0 7 0 0 0 0 0 0 0

CAGYTGFQKLVF-CASSSTRRGPLYEQYF TRAV21*01 TRAJ8*01 TRAC*01 TRBV13*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 147 0 0 0 0 0

CLVDRNTGNQFYF-CASSRSGVITDTQYF TRAV4*01 TRAJ49*01 TRAC*01 TRBV5-4*01 TRBD2*01 TRBJ2-3*01 TRBC2*01 0 0 0 0 75 0 0 0 0 0

CAENNSQGGKLIF-CASSATGFPTEAFF TRAV13-2*01 TRAJ23*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 34 0 0 0 0 0

CVVNSGGYQKVTF-CASSAPNFYEQYF TRAV12-1*01 TRAJ13*02 TRAC*01 TRBV11-2*03 None TRBJ2-7*01 TRBC2*01 0 0 0 0 30 0 0 0 0 0

CAVLDSNYQLIW-CASSQNRDLVGELFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV4-2*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 0 0 0 26 0 0 0 0 0

CAGESGGSYIPTF-CASSPPPGHSNRNRIGTEAFF TRAV25*01 TRAJ6*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 16 0 0 0 0 0

CAYDSNYQLIW-CASSSTRRGPLYEQYF TRAV2*01 TRAJ33*01 TRAC*01 TRBV13*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 13 0 0 0 0 0

CASLDSNYQLIW-CASSDSHTDTQYF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV6-4*01 None TRBJ2-3*01 TRBC2*01 0 0 0 0 11 0 0 0 0 0

CAVRDSNYQLIW-CASSHREHTEAFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV6-5*01 None TRBJ1-1*01 TRBC1*01 0 0 0 0 7 0 0 0 0 0

CAVRGQYNFNKFYF-CASSEGVGTPFDEQFF TRAV3*01 TRAJ21*01 TRAC*01 TRBV2*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 337 0 0 0 0 0 0 0 0

CAMREPADSSYKLIF-CASSYPTSGTPRNEQYF TRAV14/DV4*01 TRAJ12*01 TRAC*01 TRBV6-2*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 150 0 0 0 0 0 0 0 0

CASRGGGGSNYKLTF-CSAPGQNYEQYF TRAV24*01 TRAJ53*01 TRAC*01 TRBV29-1*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 85 0 0 0 0 0 0 0 0

CAVRGYRDDKIIF-CASSSRVAGTDTQYF TRAV3*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 53 0 0 0 0 0 0 0 0

CAMSSRF-CASSIYGQGYQPQHF TRAV14/DV4*01 TRAJ16*01 TRAC*01 TRBV19*01 TRBD1*01 TRBJ1-5*01 TRBC1*01 0 50 0 0 0 0 0 0 0 0

CAMREEYNNNDMRF-CASSSQRAGVYTGELFF TRAV14/DV4*01 TRAJ43*01 TRAC*01 TRBV7-6*01 TRBD2*02 TRBJ2-2*01 TRBC2*01 0 34 0 0 0 0 0 0 0 0

CAVGDFGNEKLTF-CSASRLRIGHGETQYF TRAV12-2*01 TRAJ48*01 TRAC*01 TRBV20-1*02 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 32 0 0 0 0 0 0 0 0

CAILNNNDMRF-CSAKTGPPGEKLFF TRAV14/DV4*01 TRAJ43*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-4*01 TRBC1*01 0 30 0 0 0 0 0 0 0 0

CAYRSKNRDDKIIF-CASSLRWASVYEQYF TRAV38-2/DV8*01TRAJ30*01 TRAC*01 TRBV7-8*01 None TRBJ2-7*01 TRBC2*01 0 26 0 0 0 0 0 0 0 0

CIVRAYSGGSNYKLTF-CASSYHSNQPQHF TRAV26-1*01 TRAJ53*01 TRAC*01 TRBV11-2*01 None TRBJ1-5*01 TRBC1*01 0 25 0 0 0 0 0 0 0 0

CAVTTPPNAGGTSYGKLTF-CASRHTGAGMWTDTQYFTRAV8-4*01 TRAJ52*01 TRAC*01 TRBV7-9*03 TRBD2*01 TRBJ2-3*01 TRBC2*01 0 22 0 0 0 0 0 0 0 0

CAVRPGRDDKIIF-CASSSRLAGGTDTQYF TRAV3*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 21 0 0 0 0 0 0 0 0

CAVRPDSNYQLIW-CASSLRTSGLSYEQYF TRAV3*01 TRAJ33*01 TRAC*01 TRBV3-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 20 0 0 0 0 0 0 0 0

CAVGYSGAGSYQLTF-CASSISGGLSTDTQYF TRAV21*01 TRAJ28*01 TRAC*01 TRBV7-6*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 20 0 0 0 0 0 0 0 0

CLVGANTNAGKSTF-CASSQDGGGPRQVEQFF TRAV4*01 TRAJ27*01 TRAC*01 TRBV4-2*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 19 0 0 0 0 0 0 0 0

CAGITDYGQNFVF-CSVEGGTLAGHYNEQFF TRAV25*01 TRAJ26*01 TRAC*01 TRBV29-1*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 19 0 0 0 0 0 0 0 0

CVVNGGNTPLVF-CASSLGWRRATGETQYF TRAV12-1*01 TRAJ29*01 TRAC*01 TRBV7-2*02 TRBD2*02 TRBJ2-5*01 TRBC2*01 0 18 0 0 0 0 0 0 0 0

CSMEYGNKLVF-CASSLEFGVSNEQYF TRAV26-1*01 TRAJ47*01 TRAC*01 TRBV11-2*01 None TRBJ2-7*01 TRBC2*01 0 18 0 0 0 0 0 0 0 0

CALSDRYTGNQFYF-CASSLVARGATDTQYF TRAV9-2*01 TRAJ49*01 TRAC*01 TRBV11-2*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 17 0 0 0 0 0 0 0 0

CAYSQETSGSRLTF-CASSVVWWSSQYF TRAV38-2/DV8*01TRAJ58*01 TRAC*01 TRBV9*01 None TRBJ2-3*01 TRBC2*01 0 17 0 0 0 0 0 0 0 0

CAAGGSARQLTF-CASSFITYGATGELFF TRAV13-1*01 TRAJ22*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 16 0 0 0 0 0 0 0 0

CAVRAF-CASSSGSLNTEAFF TRAV1-2*01 TRAJ16*01 TRAC*01 TRBV5-4*01 TRBD2*02 TRBJ1-1*01 TRBC1*01 0 16 0 0 0 0 0 0 0 0

CLVVPSGGYNKLIF-CASSFFFGVGEQYF TRAV4*01 TRAJ4*01 TRAC*01 TRBV5-5*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 16 0 0 0 0 0 0 0 0

CAYRRLGNTPLVF-CASSAVDGQGFRTDTQYF TRAV38-2/DV8*01TRAJ29*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 15 0 0 0 0 0 0 0 0

CAVGDNFNKFYF-CASSPTSATGELFF TRAV8-3*01 TRAJ21*01 TRAC*01 TRBV28*01 TRBD2*01 TRBJ2-2*01 TRBC2*01 0 15 0 0 0 0 0 0 0 0

CASTHQAGTALIF-CASSETSGGVKTGELFF TRAV1-2*01 TRAJ15*01 TRAC*01 TRBV7-9*03 TRBD2*01 TRBJ2-2*01 TRBC2*01 0 14 0 0 0 0 0 0 0 0

CAVPSGYALNF-CASSPDSSADTQYF TRAV21*01 TRAJ41*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 13 0 0 0 0 0 0 0 0

CAVGDNFNKFYF-CASTMTSATGELFF TRAV8-3*01 TRAJ21*01 TRAC*01 TRBV28*01 TRBD2*01 TRBJ2-2*01 TRBC2*01 0 13 0 0 0 0 0 0 0 0

CLVGEPLNYGGSQGNLIF-CASSLEGAVPQNSYEQYF TRAV4*01 TRAJ42*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 13 0 0 0 0 0 0 0 0

CAVIGRGGYQKVTF-CASSLASGGRTYEQYF TRAV12-2*01 TRAJ13*02 TRAC*01 TRBV5-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 12 0 0 0 0 0 0 0 0

CAMRLNRDDKIIF-CASSRRGPRPDEQYF TRAV12-3*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 12 0 0 0 0 0 0 0 0

CAGRTGNQFYF-CASSLLAAPYEQYF TRAV12-2*01 TRAJ49*01 TRAC*01 TRBV6-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 11 0 0 0 0 0 0 0 0

CAVEAAGNKLTF-CASSLISGRSETQYF TRAV21*01 TRAJ17*01 TRAC*01 TRBV5-5*01 TRBD2*02 TRBJ2-5*01 TRBC2*01 0 11 0 0 0 0 0 0 0 0

CAVGAATDKLIF-CSASPQSYEQYF TRAV8-3*01 TRAJ34*01 TRAC*01 TRBV20-1*02 None TRBJ2-7*01 TRBC2*01 0 11 0 0 0 0 0 0 0 0

CAVRGTGTASKLTF-CSGRAGGNEQFF TRAV21*01 TRAJ44*01 TRAC*01 TRBV29-1*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 11 0 0 0 0 0 0 0 0

CATDEVGGNEKLTF-CASSRRGPRPDEQYF TRAV17*01 TRAJ48*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 10 0 0 0 0 0 0 0 0

CALSELYQAGTALIF-CASSGGRGDEKLFF TRAV19*01 TRAJ15*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ1-4*01 TRBC1*01 0 10 0 0 0 0 0 0 0 0

CATDGGGADGLTF-CSAREGSGSEKYF TRAV17*01 TRAJ45*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 10 0 0 0 0 0 0 0 0

CVVRAYRDDKIIF-CASSSRLAGGITDTQYF TRAV10*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 10 0 0 0 0 0 0 0 0

CAVNRNYGGSQGNLIF-CASGDGTGELFF TRAV3*01 TRAJ42*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 10 0 0 0 0 0 0 0 0

CAFYSNSGYALNF-CASEKGLGAYEQYF TRAV38-1*01 TRAJ41*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 9 0 0 0 0 0 0 0 0

CAVYWGQKLLF-CASTDRDSSNIYEQYF TRAV29/DV5*01 TRAJ16*01 TRAC*01 TRBV5-4*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 9 0 0 0 0 0 0 0 0

CAASENYGQNFVF-CASSSRIQGGSYEQYF TRAV29/DV5*01 TRAJ26*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 9 0 0 0 0 0 0 0 0

CAMRENSKLTF-CASSPVAGDHSGNTIYF TRAV14/DV4*01 TRAJ56*01 TRAC*01 TRBV18*01 TRBD1*01 TRBJ1-3*01 TRBC1*01 0 9 0 0 0 0 0 0 0 0

CAVGAQAREYGNKLVF-CASSLNSGTYEQYF TRAV8-3*01 TRAJ47*01 TRAC*01 TRBV5-4*01 TRBD2*02 TRBJ2-7*01 TRBC1*01 0 9 0 0 0 0 0 0 0 0

CAMSLLKGFGNVLHC-CASSVGERMTEAFF TRAV12-3*01 TRAJ35*01 TRAC*01 TRBV9*01 None TRBJ1-1*01 TRBC1*01 0 8 0 0 0 0 0 0 0 0

CAVSDGTNQFYF-CASSYGGRSSYEQYF TRAV8-6*01 TRAJ49*01 TRAC*01 TRBV6-6*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 8 0 0 0 0 0 0 0 0

CAVSDGQKLLF-CASSHWEEQYF TRAV1-1*01 TRAJ16*01 TRAC*01 TRBV3-1*01 None TRBJ2-7*01 TRBC2*01 0 8 0 0 0 0 0 0 0 0

CAVNSGGGADGLTF-CASSSRTSGRDYEQYF TRAV41*01 TRAJ45*01 TRAC*01 TRBV7-9*03 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 8 0 0 0 0 0 0 0 0

CAPQTGANNLFF-CASSPGSDYGYTF TRAV14/DV4*01 TRAJ36*01 TRAC*01 TRBV7-3*01 TRBD2*02 TRBJ1-2*01 TRBC1*01 0 8 0 0 0 0 0 0 0 0

CAGREGGSYIPTF-CASSLGVGSYNEQFF TRAV27*01 TRAJ6*01 TRAC*01 TRBV13*01 None TRBJ2-1*01 TRBC2*01 0 8 0 0 0 0 0 0 0 0

CAFMKHDYKLSF-CASSGQFPSPTDTQYF TRAV38-1*01 TRAJ20*01 TRAC*01 TRBV14*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 7 0 0 0 0 0 0 0 0

CAASGTSGSRLTF-CATSLAGFSYNEQFF TRAV29/DV5*01 TRAJ58*01 TRAC*01 TRBV24-1*01 TRBD2*01 TRBJ2-1*01 TRBC1*01 0 7 0 0 0 0 0 0 0 0

CAASENYGQNFVF-CASSSRIAGGNYEQYF TRAV29/DV5*01 TRAJ26*01 TRAC*01 TRBV28*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 7 0 0 0 0 0 0 0 0

CIVVPNFGNEKLTF-CAWSEDRGQGKPEAFF TRAV26-1*01 TRAJ48*01 TRAC*01 TRBV30*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 60 0 0 0

CFYGGATNKLIF-CASSLERGRDEQYF TRAV1-2*01 TRAJ32*02 TRAC*01 TRBV5-5*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 46 0 0 0

CAVRYTGFQKLVF-CASSRESASRVGYGYTF TRAV1-2*01 TRAJ8*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 0 0 0 11 0 0 0

CERSGSNYQLIW-CASSRESASRVGYGYTF TRAV1-1*01 TRAJ33*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 0 0 0 10 0 0 0

CAVRPYRDDKIIF-CASSSRLAGGSYEQYF TRAV3*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 8 0 0 0

CAMREDTGRRALTF-CASSLGQGAANTEAFF TRAV14/DV4*02 TRAJ5*01 TRAC*01 TRBV7-8*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 6 0 0 0

CAGPISASKIIF-CAWSLRGDAEQYF TRAV13-2*01 TRAJ3*01 TRAC*01 TRBV30*01 TRBD1*01 TRBJ2-7*01 TRBC2*02 0 0 0 0 0 0 6 0 0 0

CALSDMDSNYQLIW-CASSTDLGRGSTEAFF TRAV19*01 TRAJ33*01 TRAC*01 TRBV5-8*01 TRBD2*02 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 0 134 0

CAVNPRNDYKLSF-CASSEQIEQYF TRAV12-2*01 TRAJ20*01 TRAC*01 TRBV6-1*01 None TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 0 18 0

CAVDMWDMRF-CATSDPRQGVGTGELFF TRAV39*01 TRAJ43*01 TRAC*01 TRBV24-1*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 0 0 0 0 0 0 0 9 0

CAAGTTGNQFYF-CASSQWAANTEAFF TRAV20*01 TRAJ49*01 TRAC*01 TRBV4-1*01 None TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 0 9 0

CAAIANDYKLSF-CASSLGSTPNEQFF TRAV29/DV5*01 TRAJ20*01 TRAC*01 TRBV5-4*01 None TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 0 8 0

CAVAANTDKLIF-CSASPASYEQYF TRAV8-3*01 TRAJ34*01 TRAC*01 TRBV20-1*02 None TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 0 8 0

CAVGTGGFKTIF-CASSPTGPRGGGTEAFF TRAV1-2*01 TRAJ9*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 0 7 0

CAVRDGRAAGNKLTF-CATSDFKGPDGGVTQYF TRAV1-1*01 TRAJ17*01 TRAC*01 TRBV24-1*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 0 0 0 7 0

CAVSGRTDKLIF-CSASPSSYEQYF TRAV8-6*02 TRAJ34*01 TRAC*01 TRBV20-1*02 None TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 0 7 0

CAMDSNYQLIW-CASGWESPLHF TRAV38-2/DV8*01TRAJ33*01 TRAC*01 TRBV6-5*01 TRBD2*02 TRBJ1-6*01 TRBC1*01 0 0 0 0 0 0 0 0 6 0

CAATPPASNFGNEKLTF-CASSRKWTSGDQETQYF TRAV13-1*01 TRAJ48*01 TRAC*01 TRBV7-8*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 0 0 98 0 0

CILRDNFGNEKLTF-CASSRKWTSGDQETQYF TRAV26-2*01 TRAJ48*01 TRAC*01 TRBV7-8*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 0 0 71 0 0

CAVRDQNAGNMLTF-CASSLNLGQGMNQPQHF TRAV1-2*01 TRAJ39*01 TRAC*01 TRBV5-4*01 TRBD1*01 TRBJ1-5*01 TRBC1*01 0 0 0 0 0 0 0 48 0 0

CAASGGYNKLIF-CASSLQREQYF TRAV29/DV5*01 TRAJ4*01 TRAC*01 TRBV2*01 None TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 38 0 0

CAVVDSNYQLIW-CASSHADSSSGANVLTF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV3-1*01 TRBD1*01 TRBJ2-6*01 TRBC2*01 0 0 0 0 0 0 0 29 0 0

CAMSAWEGAQKLVF-CASSYKGGVTYNEQFF TRAV12-3*01 TRAJ54*01 TRAC*01 TRBV6-6*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 27 0 0

CAMRGINTGNQFYF-CASSPTLGPRAGTDTQYF TRAV14/DV4*01 TRAJ49*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 0 0 0 0 0 0 20 0 0

CAVRDPRPGRKAYLRT-CASSHADSSSGANVLTF TRAV1-1*01 TRAJ23*01 TRAC*01 TRBV3-1*01 TRBD1*01 TRBJ2-6*01 TRBC2*01 0 0 0 0 0 0 0 18 0 0

CALGSNYQLIW-CASSYRGGNTIYF TRAV16*01 TRAJ33*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ1-3*01 TRBC1*01 0 0 0 0 0 0 0 17 0 0

CIVPQTGANNLFF-CASSTPSQGTEAFF TRAV26-1*01 TRAJ36*01 TRAC*01 TRBV11-2*03 None TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 16 0 0

CILRDVGGSQGNLIF-CASSLAVATGELFF TRAV26-2*01 TRAJ42*01 TRAC*01 TRBV5-4*01 None TRBJ2-2*01 TRBC2*01 0 0 0 0 0 0 0 15 0 0

CALSEGSGTYKYIF-CASSGSGTSGDEEFF TRAV19*01 TRAJ40*01 TRAC*01 TRBV9*01 TRBD2*01 TRBJ2-1*01 TRBC1*01 0 0 0 0 0 0 0 12 0 0

CALEADAGGTSYGKLTF-CASSPKIEAFF TRAV6*01 TRAJ52*01 TRAC*01 TRBV7-9*03 None TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 12 0 0

CAVVNQMDSNYQLIW-CASSQGGTGVAFF TRAV8-3*01 TRAJ33*01 TRAC*01 TRBV4-1*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 11 0 0

CAVAYQAGTALIF-CASEGDTQYF TRAV8-6*02 TRAJ15*01 TRAC*01 TRBV19*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 0 0 0 0 0 0 11 0 0

CAVGDPNNAGNMLTF-CASSLAGEETQYF TRAV8-3*01 TRAJ39*01 TRAC*01 TRBV5-5*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 0 0 10 0 0

CALGGMDSSYKLIF-CASRSGDTMNTEAFF TRAV19*01 TRAJ12*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 9 0 0

CIRTNFGNEKLTF-CSVEDEAPRVYNEQFF TRAV26-2*01 TRAJ48*01 TRAC*01 TRBV29-1*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 8 0 0

CALSSDRSGANNLFF-CASSMYSGSSYEQYF TRAV19*01 TRAJ36*01 TRAC*01 TRBV19*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 8 0 0

CAMRVLTQGGSEKLVF-CASSPGTVYEQYF TRAV14/DV4*02 TRAJ57*01 TRAC*01 TRBV18*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 8 0 0

CAVAIPHTGANSKLTF-CASSFGTGGTPYNEQFF TRAV8-3*01 TRAJ56*01 TRAC*01 TRBV7-8*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 8 0 0

CAVILRDQAGTALIF-CASSLGTGNTEAFF TRAV1-2*01 TRAJ15*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 7 0 0

CAVGALYGNKLVF-CATSGGGNTEAFF TRAV8-3*01 TRAJ47*01 TRAC*01 TRBV24-1*01 TRBD2*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 7 0 0

CAVMDSNYQLIW-CASSDSTSGTDTQYF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV6-4*01 TRBD2*01 TRBJ2-3*01 TRBC2*01 0 0 0 0 0 0 0 7 0 0

CAVRDIGSGGYQKVTF-CASSQDPGSTGELFF TRAV3*01 TRAJ13*02 TRAC*01 TRBV4-1*01 None TRBJ2-2*01 TRBC2*01 0 0 0 0 0 0 0 7 0 0

CAFTLIQGAQKLVF-CASSHRVTEAFF TRAV38-1*01 TRAJ54*01 TRAC*01 TRBV11-2*03 None TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 7 0 0

CAVRDRGSQGNLIF-CASSPQGGTEAFF TRAV1-2*01 TRAJ42*01 TRAC*01 TRBV18*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 7 0 0

CALSEAYRDDKIIF-CASSSPSGTGSSYNEQFF TRAV19*01 TRAJ30*01 TRAC*01 TRBV6-5*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 7 0 0

CAMRGGSGTYKYIF-CASSQDRATDTQYF TRAV14/DV4*01 TRAJ40*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 0 0 303 0 0 0 0 0 0

CAGDRDDKIIF-CASSPMVGWTDTQYF TRAV27*01 TRAJ30*01 TRAC*01 TRBV12-4*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 0 0 134 0 0 0 0 0 0

CAGVVASHAGNMLTF-CASSPMVGWTDTQYF TRAV27*01 TRAJ39*01 TRAC*01 TRBV12-4*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 0 0 131 0 0 0 0 0 0

CAASNGNNDMRF-CASSLGLAGDLDEQFF TRAV13-1*01 TRAJ43*01 TRAC*01 TRBV7-9*03 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 130 0 0 0 0 0 0

CAMRERGGGSNYKLTF-CASSTSQGGEQFF TRAV14/DV4*01 TRAJ53*01 TRAC*01 TRBV7-6*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 94 0 0 0 0 0 0

CAVQEAAGNKLTF-CASNQGLAGGRLYNEQFF TRAV20*01 TRAJ17*01 TRAC*01 TRBV19*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 81 0 0 0 0 0 0

CAIQIGDYGQNFVF-CASSVLTSGGQETQYF TRAV14/DV4*01 TRAJ26*01 TRAC*01 TRBV6-1*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 0 80 0 0 0 0 0 0

CALISNFGNEKLTF-CASSAGQVQETQYF TRAV9-2*01 TRAJ48*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 73 0 0 0 0 0 0

CAVGLSGSARQLTF-CASSQVPGLAGGLHEQYF TRAV2*01 TRAJ22*01 TRAC*01 TRBV3-1*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 56 0 0 0 0 0 0

CAVRIWAEDFGNEKLTF-CASSIGADMYEQYF TRAV3*01 TRAJ48*01 TRAC*01 TRBV19*01 None TRBJ2-7*01 TRBC2*01 0 0 0 55 0 0 0 0 0 0

CAALTSGTYKYIF-CASSLDSVDQETQYF TRAV29/DV5*01 TRAJ40*01 TRAC*01 TRBV6-5*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 54 0 0 0 0 0 0

CAVRDEGSGAGSYQLTF-CASSQDYAGGYEQYF TRAV3*01 TRAJ28*01 TRAC*01 TRBV4-3*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 52 0 0 0 0 0 0

CAVPTSGTYKYIF-CASSLVPGLAGGLVEQFF TRAV2*01 TRAJ40*01 TRAC*01 TRBV7-9*03 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 46 0 0 0 0 0 0

CAEGGGSYIPTF-CASSLTQGAQETQYF TRAV5*01 TRAJ6*01 TRAC*01 TRBV7-8*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 45 0 0 0 0 0 0

CALSELYSGGGADGLTF-CASSPGLAGDLYEQYF TRAV19*01 TRAJ45*01 TRAC*01 TRBV13*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 35 0 0 0 0 0 0

CVVSDRGSTLGRLYF-CASSEGGKGQPQHF TRAV10*01 TRAJ18*01 TRAC*01 TRBV25-1*01 TRBD2*01 TRBJ1-5*01 TRBC1*01 0 0 0 33 0 0 0 0 0 0

CAGLFQGGSEKLVF-CASSAWTDDYNEQFF TRAV25*01 TRAJ57*01 TRAC*01 TRBV5-6*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 30 0 0 0 0 0 0

CIVRGGGSNYKLTF-CASSEDPGGRPQHF TRAV26-1*01 TRAJ53*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ1-5*01 TRBC1*01 0 0 0 28 0 0 0 0 0 0

CIVMGGSNYKLTF-CSARDRGSSNSPLHF TRAV26-1*01 TRAJ53*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-6*02 TRBC1*01 0 0 0 28 0 0 0 0 0 0

CAMSKFTSGTYKYIF-CASSPYDREGGYTF TRAV12-3*01 TRAJ40*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 26 0 0 0 0 0 0

CIVRVDNTGKLIF-CASRAGPHYEQYF TRAV26-1*01 TRAJ37*01 TRAC*01 TRBV6-1*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 26 0 0 0 0 0 0

CASEMKTSYDKVIF-CASSPGLAGDLYEQYF TRAV24*01 TRAJ50*01 TRAC*01 TRBV13*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 24 0 0 0 0 0 0

CALSEYAQGGSEKLVF-CASSAPSGDTYEQYF TRAV19*01 TRAJ57*01 TRAC*01 TRBV28*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 24 0 0 0 0 0 0

CIVRVVRGAGGTSYGKLTF-CSARDRGSSNSPLHF TRAV26-1*01 TRAJ52*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-6*02 TRBC1*01 0 0 0 22 0 0 0 0 0 0

CIVSGGSNYKLTF-CSVRGRGSTNSPLHF TRAV26-1*01 TRAJ53*01 TRAC*01 TRBV20-1*02 None TRBJ1-6*02 TRBC1*01 0 0 0 20 0 0 0 0 0 0

CAVNFF-CASSTGTSLYNEQFF TRAV12-2*01 TRAJ16*01 TRAC*01 TRBV7-9*03 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 19 0 0 0 0 0 0

CILIYSGAGSYQLTF-CASSTLFFEGQVRGYTF TRAV26-2*01 TRAJ28*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 19 0 0 0 0 0 0

CLVGSYGGATNKLIF-CASSYHAPGQGNTEAFF TRAV4*01 TRAJ32*02 TRAC*01 TRBV6-2*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 19 0 0 0 0 0 0

CAASIMGNTPLVF-CASSSGTGVYNEQFF TRAV13-1*01 TRAJ29*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 18 0 0 0 0 0 0

CAMSQGAQKLVF-CASSPGAGSIVEKLFF TRAV12-3*01 TRAJ54*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ1-4*01 TRBC1*01 0 0 0 17 0 0 0 0 0 0

CAVGATSYSGYSTLTF-CASSENRGTYNEQFF TRAV8-3*01 TRAJ11*01 TRAC*01 TRBV5-4*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 16 0 0 0 0 0 0

CVAREAGGGNKLTF-CASSQGQGTGYTF TRAV12-1*01 TRAJ10*01 TRAC*01 TRBV6-5*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 16 0 0 0 0 0 0

CVVTTTSGTYKYIF-CASSQEAYGYTF TRAV12-1*01 TRAJ40*01 TRAC*01 TRBV16*01 TRBD2*02 TRBJ1-2*01 TRBC1*01 0 0 0 15 0 0 0 0 0 0

CVVRPGSHALNF-CASSLASGVGTGELFF TRAV10*01 TRAJ41*01 TRAC*01 TRBV7-8*01 TRBD2*01 TRBJ2-2*01 TRBC2*01 0 0 0 15 0 0 0 0 0 0

CALPSYNTDKLIF-CSVVAGGPRTDTQYF TRAV9-2*01 TRAJ34*01 TRAC*01 TRBV29-1*01 TRBD2*01 TRBJ2-3*01 TRBC2*01 0 0 0 14 0 0 0 0 0 0

CAGHPSNTGKLIF-CASSPVPGQEYGYTF TRAV35*01 TRAJ37*02 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 14 0 0 0 0 0 0

CAVCDYKLSF-CASSSHGQGLDEQFF TRAV21*01 TRAJ20*01 TRAC*01 TRBV7-6*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 13 0 0 0 0 0 0

CAVKDSNYQLIW-CASGTDDSTDTQYF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ2-3*01 TRBC1*01 0 0 0 13 0 0 0 0 0 0

CALTGAHSGGYQKVTF-CASSPGSHEQYF TRAV9-2*01 TRAJ13*02 TRAC*01 TRBV18*01 None TRBJ2-7*01 TRBC2*01 0 0 0 13 0 0 0 0 0 0

CAVSRQGSYIPTF-CASSSGQGHSTDTQYF TRAV3*01 TRAJ6*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 0 0 12 0 0 0 0 0 0

CVVNKGGKLIF-CASSQEVGTSSEQYF TRAV12-1*01 TRAJ37*01 TRAC*01 TRBV4-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 11 0 0 0 0 0 0

CVVSDSGSARQLTF-CASSLVPGGLPYNEQFF TRAV8-2*01 TRAJ22*01 TRAC*01 TRBV5-1*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 11 0 0 0 0 0 0

CAENPLQGAQKLVF-CASTPRGRQGIRGYTF TRAV13-2*01 TRAJ54*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 10 0 0 0 0 0 0

CATQGAQKLVF-CSVRGRGSTNSPLHF TRAV17*01 TRAJ54*01 TRAC*01 TRBV20-1*02 None TRBJ1-6*02 TRBC1*01 0 0 0 10 0 0 0 0 0 0

CAGRSHNTGNQFYF-CASSQDLGQGGTGELFF TRAV35*01 TRAJ49*01 TRAC*01 TRBV4-1*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 0 0 10 0 0 0 0 0 0

CAVRDQYNFNKFYF-CASSQDAGSVPHGYTF TRAV3*01 TRAJ21*01 TRAC*01 TRBV4-1*01 TRBD2*01 TRBJ1-2*01 TRBC1*01 0 0 0 10 0 0 0 0 0 0

CAVSPGNTGKLIF-CSARDESTGVRDTQYF TRAV1-2*01 TRAJ37*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 0 0 10 0 0 0 0 0 0

CAVEGGVTSGTYKYIF-CAISGPGPGGYYEQYF TRAV36/DV7*01 TRAJ40*01 TRAC*01 TRBV10-3*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 9 0 0 0 0 0 0

CALSGGSNYKLTF-CSARQGNEKLFF TRAV9-2*01 TRAJ53*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-4*01 TRBC1*01 0 0 0 9 0 0 0 0 0 0

CAVMDSSYKLIF-CASSELAGGPNEQFF TRAV1-2*01 TRAJ12*01 TRAC*01 TRBV6-1*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 9 0 0 0 0 0 0

CALSEEYYGGSQGNLIF-CATSDSDRGRDEQYF TRAV19*01 TRAJ42*01 TRAC*01 TRBV24-1*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 8 0 0 0 0 0 0

CAVLLWKAAGNKLTF-CSARDGGSGSAREQFF TRAV22*01 TRAJ17*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 8 0 0 0 0 0 0

CAVSRDRDDKIIF-CASSQVIQVNYGYTF TRAV20*01 TRAJ30*01 TRAC*01 TRBV4-1*01 None TRBJ1-2*01 TRBC1*01 0 0 0 8 0 0 0 0 0 0

CVVSVRMDSSYKLIF-CASSSLSGGGGNEQFF TRAV8-2*01 TRAJ12*01 TRAC*01 TRBV6-6*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 7 0 0 0 0 0 0

CAVRPFNTGFQKLVF-CSALPGQGGNSPLHF TRAV1-2*01 TRAJ8*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-6*02 TRBC1*01 0 0 0 7 0 0 0 0 0 0

CAVGRGSNYKLTF-CASSFGSQPQHF TRAV8-3*01 TRAJ53*01 TRAC*01 TRBV28*01 None TRBJ1-5*01 TRBC1*01 0 0 0 7 0 0 0 0 0 0

CAVNSFTSGTYKYIF-CASSLAGDPYNEQFF TRAV12-2*01 TRAJ40*01 TRAC*01 TRBV7-8*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 7 0 0 0 0 0 0

CAYRSPTSGTYKYIF-CASSAGQERAFF TRAV38-2/DV8*01TRAJ40*01 TRAC*01 TRBV25-1*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 7 0 0 0 0 0 0

CAVRDWDSNYQLIW-CASIVDTEAFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV2*01 None TRBJ1-1*01 TRBC1*01 0 0 0 7 0 0 0 0 0 0

CAASKGNARLMF-CSATSTGSISYEQYF TRAV13-1*01 TRAJ31*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 7 0 0 0 0 0 0

CAMRERLGSASKIIF-CSARDTGPYEQYF TRAV14/DV4*02 TRAJ3*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 85 0 0 0 0

CASDNAGNMLTF-CASSPQSQNIQYF TRAV12-2*01 TRAJ39*01 TRAC*01 TRBV9*01 None TRBJ2-4*01 TRBC2*01 0 0 0 0 0 72 0 0 0 0

CAENSHFNAGGTSYGKLTF-CASSYSGHPGRAFF TRAV13-2*01 TRAJ52*01 TRAC*01 TRBV5-1*01 TRBD2*02 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 23 0 0 0 0

CALPPDGQKLLF-CSARDTGPYEQYF TRAV6*01 TRAJ16*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 22 0 0 0 0

CALEAGNMLTF-CSVEPDRGRKETQYF TRAV6*01 TRAJ39*01 TRAC*01 TRBV29-1*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 16 0 0 0 0

CLVGGYNKLIF-CASSPTTRSTSYNEQFF TRAV4*01 TRAJ4*01 TRAC*01 TRBV28*01 None TRBJ2-1*01 TRBC2*01 0 0 0 0 0 14 0 0 0 0

CAVYDYKLSF-CASSQERGVYNEQFF TRAV12-2*01 TRAJ20*01 TRAC*01 TRBV3-1*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 14 0 0 0 0

CATDSTSGTYKYIF-CASSLEGASGYTF TRAV17*01 TRAJ40*01 TRAC*01 TRBV13*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 0 0 14 0 0 0 0

CAGEDYGQNFVF-CASSLGWNEQFF TRAV27*01 TRAJ26*01 TRAC*01 TRBV7-9*03 None TRBJ2-1*01 TRBC2*01 0 0 0 0 0 12 0 0 0 0

CAVSSSGGYQKVTF-CSARDPRWGEKLFF TRAV8-6*01 TRAJ13*02 TRAC*01 TRBV20-1*02 TRBD2*01 TRBJ1-4*01 TRBC1*01 0 0 0 0 0 9 0 0 0 0

CAVSDRTDKLIF-CSASPSSYEQYF TRAV8-6*02 TRAJ34*01 TRAC*01 TRBV20-1*02 None TRBJ2-7*01 TRBC1*01 0 0 0 0 0 9 0 0 0 0

CAVIDLYSGAGSYQLTF-CASSIVGNSGELFF TRAV8-1*01 TRAJ28*01 TRAC*01 TRBV19*01 None TRBJ2-2*01 TRBC2*01 0 0 0 0 0 9 0 0 0 0

CAPPLSSGSARQLTF-CASSLGWNEQFF TRAV16*01 TRAJ22*01 TRAC*01 TRBV7-9*03 None TRBJ2-1*01 TRBC2*01 0 0 0 0 0 8 0 0 0 0

CAMWSSGGSNYKLTF-CASNLGATGELFF TRAV12-3*01 TRAJ53*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 0 0 0 0 8 0 0 0 0

CAARIQGAQKLVF-CASSPGGAAKNIQYF TRAV29/DV5*01 TRAJ54*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ2-4*01 TRBC2*01 0 0 0 0 0 8 0 0 0 0

CAPQDSNYQLIW-CSAFSGSEHNEQFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 7 0 0 0 0

CALVETGANNLFF-CASSLPGMNTEAFF TRAV19*01 TRAJ36*01 TRAC*01 TRBV11-3*01 TRBD2*02 TRBJ1-1*01 TRBC2*02 0 0 0 0 0 0 0 0 0 147

CASPGAGSYQLTF-CASSLWSATNEKLFF TRAV36/DV7*01 TRAJ28*01 TRAC*01 TRBV28*01 None TRBJ1-4*01 TRBC2*02 0 0 0 0 0 0 0 0 0 48

CAVGDNAGNMLTF-CASSEVWASDHEQYF TRAV22*01 TRAJ39*01 TRAC*01 TRBV6-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*02 0 0 0 0 0 0 0 0 0 45

CATDRGDYKLSF-CASSLFLSSYNSPLHF TRAV17*01 TRAJ20*01 TRAC*01 TRBV27*01 None TRBJ1-6*02 TRBC2*02 0 0 0 0 0 0 0 0 0 43

CIVRVQPLNDYKLSF-CASSFGGREAGNTIYF TRAV26-1*01 TRAJ20*01 TRAC*01 TRBV12-4*01 TRBD1*01 TRBJ1-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 37

CALGPDKLIF-CASSPHTSTDTQYF TRAV14/DV4*01 TRAJ34*01 TRAC*01 TRBV7-9*03 None TRBJ2-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 23

CALPGPHFNKFYF-CASSDRDRELFF TRAV6*01 TRAJ21*01 TRAC*01 TRBV6-5*01 None TRBJ2-2*01 TRBC2*02 0 0 0 0 0 0 0 0 0 17

CAAYTGRRALTF-CASSRQGVLEAFF TRAV12-2*01 TRAJ5*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 0 0 14

CAVGASNDYKLSF-CASSLYRDISYEQYF TRAV8-3*01 TRAJ20*01 TRAC*01 TRBV4-3*01 TRBD1*01 TRBJ2-7*01 TRBC2*02 0 0 0 0 0 0 0 0 0 13

CAFATGNQFYF-CASSAVLAGGTDTQYF TRAV38-1*01 TRAJ49*01 TRAC*01 TRBV11-2*01 TRBD2*01 TRBJ2-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 12

CAGQAGTALIF-CASSQGEGGYTF TRAV12-2*01 TRAJ15*01 TRAC*01 TRBV4-1*01 TRBD2*01 TRBJ1-2*01 TRBC2*02 0 0 0 0 0 0 0 0 0 12

CAVQAEGNAGNMLTF-CASSFQAGSISGNTIYF TRAV20*01 TRAJ39*01 TRAC*01 TRBV7-2*01 TRBD2*01 TRBJ1-3*01 TRBC1*01 0 0 0 0 0 0 0 0 0 12

CAVRDEGGSYIPTF-CASSLEWVDTQYF TRAV3*01 TRAJ6*01 TRAC*01 TRBV7-2*01 TRBD1*01 TRBJ2-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 9

CAVRGNTDKLIF-CASSFQAGSISGNTIYF TRAV21*01 TRAJ34*01 TRAC*01 TRBV7-2*01 TRBD2*01 TRBJ1-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 9

CASGGEYGNKLVF-CATSRDQRGVYGYTF TRAV12-3*01 TRAJ47*01 TRAC*01 TRBV15*01 TRBD2*01 TRBJ1-2*01 TRBC1*01 0 0 0 0 0 0 0 0 0 8

CALSGTSF-CASSPPSTGTGELFF TRAV19*01 TRAJ16*01 TRAC*01 TRBV9*01 TRBD2*01 TRBJ2-2*01 TRBC2*02 0 0 0 0 0 0 0 0 0 8

CAASQGAQKLVF-CASSQDGRQTSYEQYF TRAV29/DV5*01 TRAJ54*01 TRAC*01 TRBV4-1*01 TRBD2*02 TRBJ2-7*01 TRBC2*02 0 0 0 0 0 0 0 0 0 7

CAVGDNFNKFYF-CASSRTSATGELFF TRAV8-3*01 TRAJ21*01 TRAC*01 TRBV28*01 TRBD2*01 TRBJ2-2*01 TRBC2*02 0 0 0 0 0 0 0 0 0 7

CAESSGGYQKVTF-CASGFGSGNTIYF TRAV5*01 TRAJ13*02 TRAC*01 TRBV12-5*01 None TRBJ1-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 7

Table S10 List of the most enriched clone antibodies in each patient by BCR single cell transcriptome analysis

IGLorK_CDR3_IGH_CDR3 IGLorK_v_gene IGLorK_j_gene IGLorK_c_gene IGH_v_gene IGH_d_gene IGH_j_gene IGH_c_genePatient1 Patient2 Patient3Patient

4Patient5

Patient

6Patient7

Patient

8Patient9 Patient10

CQAGDSSTHVIL_CAGNTGYYYYYGMDVW IGLV3-1*01 IGLJ2*01 IGLC3*01 IGHV4-34*01 IGHD2-8*02 IGHJ6*02 IGHG2*03 4 0 0 0 0 0 0 0 0 0

CQAGDNNIHVVL_CAGNTGYYYYYGLDVW IGLV3-1*01 IGLJ2*01 IGLC3*01 IGHV4-34*01 IGHD2-8*02 IGHJ6*02 IGHG3*01 3 0 0 0 0 0 0 0 0 0

CQTWGTGLQVF_CAREWADSTSSAFDYW IGLV4-69*02 IGLJ2*01 IGLC3*01 IGHV3-30-3*03 IGHD1-1*01 IGHJ4*02 IGHG1*01 3 0 0 0 0 0 0 0 0 0

CMQATQFPLTF_CVREVYGDPFDYW IGKV2-24*01 IGKJ4*01 IGKC*01 IGHV3-30-3*01 IGHD4/OR15-4a*01 IGHJ4*02 IGHA1*01 0 0 14 0 0 0 0 0 0 0

CQQYYNTPYTF_CARDAVGATDRIPFDYW IGKV4-1*01 IGKJ2*01 IGKC*01 IGHV3-74*01 IGHD1-26*01 IGHJ4*02 IGHM*01 0 0 3 0 0 0 0 0 0 0

CQQYYTTWTF_CSSTVAEGIDYW IGKV4-1*01 IGKJ1*01 IGKC*01 IGHV3-15*01 IGHD6-19*01 IGHJ4*02 IGHM*01 0 0 3 0 0 0 0 0 0 0

CHQYYRNPYTF_CARVKDWELLPLSYW IGKV4-1*01 IGKJ2*01 IGKC*01 IGHV5-51*01 IGHD1-26*01 IGHJ4*02 IGHG1*01 0 0 0 0 5 0 0 0 0 0

CQQSYRTPFTF_CARHKGGDNRFDPW IGKV1-39*01 IGKJ4*01 IGKC*01 IGHV4-39*01 IGHD3-16*01 IGHJ5*02 IGHM*01 0 0 0 0 5 0 0 0 0 0

CQVAGISGDHVIF_CGRGRVGRTHVAVDVW IGLV3-21*01 IGLJ2*01 IGLC3*01 IGHV3-33*01 IGHD2-15*01 IGHJ6*02 IGHD*01 0 0 0 0 4 0 0 0 0 0

CATRDDSLSVRVF_CASGQEYSGYDSAYW IGLV1-47*02 IGLJ3*02 IGLC3*01 IGHV3-30-3*03 IGHD5-12*01 IGHJ4*02 IGHA1*01 0 5 0 0 0 0 0 0 0 0

CELYLGRGISVF_CATGGREQFNW IGLV8-61*02 IGLJ3*02 IGLC3*01 IGHV3-7*01 IGHD1-26*01 IGHJ4*02 IGHA2*01 0 3 0 0 0 0 0 0 0 0

CTQATQFPYTF_CARDRDYIDYW IGKV2-24*01 IGKJ2*01 IGKC*01 IGHV1-18*01 None IGHJ4*02 IGHA1*01 0 0 0 0 0 0 5 0 0 0

CMQGTHWITF_CARDDDTDPSHFDHW IGKV2-30*01 IGKJ5*01 IGKC*01 IGHV3-48*02 IGHD4-11*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 3 0 0 0

CMQTTQFPQTF_CAKRREIFWLGEGRGTPDY

WIGKV2-24*01 IGKJ4*01 IGKC*01 IGHV3-30*18 IGHD3-10*01 IGHJ4*02 IGHG1*01 0 0 0 0 0 0 3 0 0 0

CQQLSDNLPWTF_CARKIKEPGRYFDYW IGKV1-9*01 IGKJ2*02 IGKC*01 IGHV7-4-1*02 IGHD1-26*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 3 0 0 0

CQQYGSSPWTF_CARVAESYYDFWSAKWEG

AFDIWIGKV3-20*01 IGKJ1*01 IGKC*01 IGHV3-53*01 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 361 0 0

CQQYNSYSF_CARSGPITIFGVVIKGRGGDAFD

IWIGKV1-5*01 IGKJ3*01 IGKC*01 IGHV1-2*04 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 119 0 0

CYSTDSSGNHYVF_CARVAESYYDFWSAKWE

GAFDIWIGLV3-10*02 IGLJ1*01 IGLC1*01 IGHV3-53*01 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 7 0 0

CKQGIHLPYTF_CARDGDSYGHDFDYW IGKV2-29*02 IGKJ2*01 IGKC*01 IGHV3-74*01 IGHD5-18*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 0 7 0 0

CMQGSHWPRTF_CARDRFFRTFDYW IGKV2-30*01 IGKJ1*01 IGKC*01 IGHV3-7*01 IGHD3/OR15-3a*01 IGHJ4*02 IGHM*01 0 0 0 0 0 0 0 6 0 0

CSYAGGYTWVF_CTRDVSYSSNCW IGLV2-8*02 IGLJ3*02 IGLC3*01 IGHV3-74*01 IGHD6-19*01 IGHJ4*02 IGHG2*04 0 0 0 0 0 0 0 5 0 0

CQSYDSSLYGVIF_CARVAESYYDFWSAKWE

GAFDIWIGLV1-40*01 IGLJ2*01 IGLC3*01 IGHV3-53*01 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 5 0 0

CSYAGSSTFVF_CAKNTDYDFWSDYPKGYWF

GPWIGLV2-23*03 IGLJ1*01 IGLC1*01 IGHV3-23D*01 IGHD3-3*01 IGHJ5*02 IGHA1*01 0 0 0 0 0 0 0 4 0 0

CMQTLQTPHSF_CARGHSNYWSLSAVSLGYW IGKV2-28*01 IGKJ4*01 IGKC*01 IGHV3-11*06 IGHD4-11*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 0 4 0 0

CSSYTTSTSPGF_CARDRTPNLSVLLSQFDYW IGLV2-14*02 IGLJ2*01 IGLC3*01 IGHV4-38-2*02 IGHD2/OR15-2a*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 0 4 0 0

CMQALQTPLTF_CAKDLTPDGRWDIDYW IGKV2-28*01 IGKJ4*01 IGKC*01 IGHV3-23D*01 IGHD4-23*01 IGHJ4*02 IGHM*01 0 0 0 0 0 0 0 3 0 0

CQSYDSSLYGVIF_CARSGPITIFGVVIKGRGG

DAFDIWIGLV1-40*01 IGLJ2*01 IGLC3*01 IGHV1-2*04 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 3 0 0

CQPYNTYWTF_CARDRSRFCSGDSCFPFDLW IGKV1-5*01 IGKJ1*01 IGKC*01 IGHV1-18*01 IGHD2-15*01 IGHJ4*02 IGHA1*01 0 0 0 7 0 0 0 0 0 0

CGTWDSSLSAGVF_CARDPATFSIYFPSGAPIL

GWIGLV1-41*01 IGLJ3*02 IGLC3*01 IGHV3-30-3*03 IGHD2/OR15-2a*01 IGHJ4*02 IGHG1*01 0 0 0 5 0 0 0 0 0 0

CQQYFSTPHTF_CARKQWLGPIDYW IGKV4-1*01 IGKJ2*01 IGKC*01 IGHV4-34*01 IGHD6-19*01 IGHJ4*02 IGHM*01 0 0 0 4 0 0 0 0 0 0

CQQYYSIPSLTF_CATHRTYFDWLLPFDYW IGKV4-1*01 IGKJ4*01 IGKC*01 IGHV3-30-3*03 IGHD3-9*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 179 0 0 0 0

CQHYYSSPPWTF_CARHRRSGSYGEALDLW IGKV4-1*01 IGKJ1*01 IGKC*01 IGHV1-18*01 IGHD1-26*01 IGHJ3*01 IGHA1*01 0 0 0 0 0 154 0 0 0 0

CSSYTSAATLVF_CARDPHTYDFWSEGDFL IGLV2-14*02 IGLJ3*02 IGLC3*01 IGHV1-2*02 IGHD3-3*01 IGHJ4*02 IGHG1*01 0 0 0 0 0 134 0 0 0 0

CQQSYNTPYTF_CARDRNYDFWNGFYTSNYY

YMDVWIGKV1-39*01 IGKJ2*01 IGKC*01 IGHV3-66*01 IGHD3-3*01 IGHJ6*03 IGHG1*01 0 0 0 0 0 129 0 0 0 0

CQVWDSTRDHPGVF_CAKSETSFGVTAPFDY

WIGLV3-21*01 IGLJ1*01 IGLC1*01 IGHV3-30*18 IGHD3-3*02 IGHJ4*02 IGHA1*01 0 0 0 0 0 93 0 0 0 0

CQQYNNLVLTF_CAKDERAYYHYMDVW IGKV1D-33*01 IGKJ4*01 IGKC*01 IGHV3-9*01 IGHD1-1*01 IGHJ6*03 IGHA1*01 0 0 0 0 0 76 0 0 0 0

CLAWDDKNVVF_CARIHYYESNVYDHW IGLV3-1*01 IGLJ2*01 IGLC3*01 IGHV2-26*01 IGHD3-22*01 IGHJ4*01 IGHA1*01 0 0 0 0 0 70 0 0 0 0

CMQALQTPETF_CARTQYSSSSDYW IGKV2-28*01 IGKJ1*01 IGKC*01 IGHV3-21*01 IGHD6-6*01 IGHJ4*02 IGHM*01 0 0 0 0 0 60 0 0 0 0

CSSYAGSNNWVF_CARDDSAGILTGIGGYW IGLV2-8*02 IGLJ3*02 IGLC3*01 IGHV1-2*02 IGHD3-9*01 IGHJ4*02 IGHM*01 0 0 0 0 0 40 0 0 0 0

CQQAKSFPLTF_CTRYSLSSGWIDPW IGKV1-12*02 IGKJ4*01 IGKC*01 IGHV3-49*03 IGHD6-6*01 IGHJ5*02 IGHA1*01 0 0 0 0 0 37 0 0 0 0

CQAWDSTTVLF_CARDPHTYDFWSEGDFL IGLV3-1*01 IGLJ2*01 IGLC2*02 IGHV1-2*02 IGHD3-3*01 IGHJ4*02 IGHG1*01 0 0 0 0 0 23 0 0 0 0

CGAWDDTLSAAVF_CARVFMLRDVDWSKTSQ

NYYMDVWIGLV1-41*01 IGLJ2*01 IGLC3*01 IGHV4-59*01 IGHD3-9*01 IGHJ6*03 IGHA1*01 0 0 0 0 0 10 0 0 0 0

CQQYNNLVLTF_CARGIAARTFDYW IGKV1D-33*01 IGKJ4*01 IGKC*01 IGHV3-74*01 IGHD6-6*01 IGHJ4*02 IGHM*01 0 0 0 0 0 9 0 0 0 0

CNSFTTSSTLVF_CAKDERAYYHYMDVW IGLV2-14*02 IGLJ2*01 IGLC1*01 IGHV3-9*01 IGHD1-1*01 IGHJ6*03 IGHA1*01 0 0 0 0 0 7 0 0 0 0

CSSYTSAATLVF_CVRQVFTLLGVPKNNYFDP

WIGLV2-14*02 IGLJ3*02 IGLC3*01 IGHV4-39*01 IGHD3-3*01 IGHJ5*02 IGHA1*01 0 0 0 0 0 7 0 0 0 0

CMQALQTPETF_CARGTAYYYGSGSYYKVLS

GHHFDYWIGKV2-28*01 IGKJ1*01 IGKC*01 IGHV4-34*01 IGHD3-10*01 IGHJ4*02 IGHD*01 0 0 0 0 0 3 0 0 0 0

CLLYYGGAQRVVF_CARVFSAIFLKIDYW IGLV7-43*01 IGLJ2*01 IGLC3*01 IGHV1-18*01 IGHD3-9*01 IGHJ4*02 IGHM*03 0 0 0 0 0 3 0 0 0 0

CKSYEGSQSYVF_CAKYHYGSGTSSGYW IGLV2-14*02 IGLJ1*01 IGLC1*01 IGHV3-7*01 IGHD3-10*01 IGHJ4*02 IGHG2*03 0 0 0 0 0 0 0 0 3 0

CQQSYSTPALTF_CARSAPVVGATISYYGMDV

WIGKV1-39*01 IGKJ4*01 IGKC*01 IGHV1-2*02 IGHD1-26*01 IGHJ6*02 IGHD*01 0 0 0 0 0 0 0 0 3 0

CQQTYSTPRLTF_CARSHDSSDYYYRTYYYG

MDVWIGKV1-39*01 IGKJ4*01 IGKC*01 IGHV5-51*01 IGHD3-22*01 IGHJ6*02 IGHA1*01 0 0 0 0 0 0 0 0 3 0

CQQYYSTQTF_CARDLTGYFDYW IGKV4-1*01 IGKJ1*01 IGKC*01 IGHV3-33*01 IGHD7-27*01 IGHJ4*02 IGHM*03 0 0 0 0 0 0 0 0 3 0

CSSYAGSNNYVF_CARHRSGGYYDYW IGLV2-8*02 IGLJ1*01 IGLC1*01 IGHV3-9*03 IGHD3-10*01 IGHJ4*02 IGHM*01 0 0 0 0 0 0 0 0 3 0

CLLSYSGPWVF_CARARGGSYSVSQSEGRLD

YWIGLV7-46*02 IGLJ3*02 IGLC3*01 IGHV1-18*01 IGHD1-26*01 IGHJ4*02 IGHA2*01 0 0 0 0 0 0 0 0 3 0

CAAWDDSLSGNWVF_CARDQSIHDILTGYYYG

MDVWIGLV1-47*02 IGLJ3*02 IGLC3*01 IGHV1-18*01 IGHD3-9*01 IGHJ6*02 IGHG1*01 0 0 0 0 0 0 0 0 0 11

CMQGIHLPFTF_CARAGYSSGWYLGDYYYYG

MDVWIGKV2-29*02 IGKJ3*01 IGKC*01 IGHV1-69*01 IGHD6-19*01 IGHJ6*02 IGHG1*01 0 0 0 0 0 0 0 0 0 5

CQKYNSAPRTF_CARIQLWLDYYYYYGMDVW IGKV1-27*01 IGKJ1*01 IGKC*01 IGHV4-34*01 IGHD5-18*01 IGHJ6*02 IGHG1*01 0 0 0 0 0 0 0 0 0 5

CAAWDDSLNGWVF_CARDEYYGSGSYYSLGY

YYYGMDVWIGLV1-47*02 IGLJ3*02 IGLC3*01 IGHV1-69*01 IGHD3-10*01 IGHJ6*02 IGHG1*01 0 0 0 0 0 0 0 0 0 5

CMQGTHWPPLTF_CARGPPRLNFDWLLLENN

WFDPWIGKV2-30*01 IGKJ4*01 IGKC*01 IGHV3-11*06 IGHD3-9*01 IGHJ5*02 IGHG1*01 0 0 0 0 0 0 0 0 0 4

CSSYTSSSISYVF_CARVRRVWTTGTGVAFDI

WIGLV2-14*02 IGLJ1*01 IGLC1*01 IGHV4-4*07 IGHD1-1*01 IGHJ3*02 IGHG1*01 0 0 0 0 0 0 0 0 0 4

CGTWDSDLSAWVF_CARIRRESGSQFSIDYW IGLV1-41*01 IGLJ2*01 IGLC3*01 IGHV2-70*15 IGHD1-26*01 IGHJ4*02 IGHM*01 0 0 0 0 0 0 0 0 0 4

References and Notes

References and Notes:

1. M. R. Duffy et al., Zika virus outbreak on Yap Island, Federated States of Micronesia. The New England journal of medicine 360, 2536-2543 (2009).2. Y. P. Wu, R. Wei, P. G. de Groot, SARS in Hong Kong. The New England journal of medicine 349, 708-709 (2003).3. C. J. Peters, Marburg and Ebola--arming ourselves against the deadly filoviruses. The New England journal of medicine 352, 2571-2573 (2005).4. N. Zhu et al., A Novel Coronavirus from Patients with Pneumonia in China, 2019. The New England journal of medicine 382, 727-733 (2020).5. F. Wu et al., A new coronavirus associated with human respiratory disease in China. Nature, (2020).6. D. Wang et al., Clinical Characteristics of 138 Hospitalized Patients With 2019 Novel Coronavirus-Infected Pneumonia in Wuhan, China. Jama, (2020).7. Q. Li et al., Early Transmission Dynamics in Wuhan, China, of Novel Coronavirus-Infected Pneumonia. (2020).8. M. L. Holshue et al., First Case of 2019 Novel Coronavirus in the United States. The New England journal of medicine, (2020).9. W. J. Guan et al., Clinical Characteristics of Coronavirus Disease 2019 in China. The New England journal of medicine, (2020).10. J. F. Chan et al., A familial cluster of pneumonia associated with the 2019 novel coronavirus indicating person-to-person transmission: a study of a family cluster.

Lancet (London, England) 395, 514-523 (2020).11. A. L. Phelan, R. Katz, L. O. Gostin, The Novel Coronavirus Originating in Wuhan, China: Challenges for Global Health Governance. Jama, (2020).12. N. Chen et al., Epidemiological and clinical characteristics of 99 cases of 2019 novel coronavirus pneumonia in Wuhan, China: a descriptive study. Lancet (London,

England) 395, 507-513 (2020).13. C. Huang et al., Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China. Lancet (London, England) 395, 497-506 (2020).14. R. J. M. Bashford-Rogers et al., Analysis of the B cell receptor repertoire in six immune-mediated diseases. Nature 574, 122-126 (2019).15. J. E. Park et al., A cell atlas of human thymic development defines T cell repertoire formation. Science 367, (2020).16. C. Soto et al., High frequency of shared clonotypes in human B cell receptor repertoires. Nature 566, 398-402 (2019).17. J. Glanville et al., Identifying specificity groups in the T cell receptor repertoire. Nature 547, 94-98 (2017).18. M. J. T. Stubbington, O. Rozenblatt-Rosen, A. Regev, S. A. Teichmann, Single-cell transcriptomics to explore the immune system in health and disease. Science 358,

58-63 (2017).19. C. Lupfer, T. D. Kanneganti, The expanding role of NLRs in antiviral immunity. Immunological reviews 255, 13-24 (2013).20. L. Unterholzner, The interferon response to intracellular DNA: why so many receptors? Immunobiology 218, 1312-1321 (2013).21. B. Kroczynska, S. Mehrotra, A. D. Arslan, S. Kaur, L. C. Platanias, Regulation of interferon-dependent mRNA translation of target genes. Journal of interferon &

cytokine research : the official journal of the International Society for Interferon and Cytokine Research 34, 289-296 (2014).22. K. C. Chiang et al., Interferon alpha-inducible protein 27 is an oncogene and highly expressed in cholangiocarcinoma patients with poor survival. Cancer

management and research 11, 1893-1905 (2019).23. A. L. Brass et al., The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus. Cell 139, 1243-1254 (2009).24. A. R. Everitt et al., IFITM3 restricts the morbidity and mortality associated with influenza. Nature 484, 519-523 (2012).25. T. Y. Lin et al., Amphotericin B increases influenza A virus infection by preventing IFITM3-mediated restriction. Cell Rep 5, 895-908 (2013).26. Y. Cao et al., Differential responses of innate immunity triggered by different subtypes of influenza a viruses in human and avian hosts. BMC Med Genomics 10, 70

(2017).27. Y. Zhang et al., MKP-1 is necessary for T cell activation and function. J Biol Chem 284, 30815-30824 (2009).28. J. T. O'Neal et al., West Nile Virus-Inclusive Single-Cell RNA Sequencing Reveals Heterogeneity in the Type I Interferon Response within Single Cells. J Virol 93,

(2019).29. J. T. O'Neal et al., West Nile Virus-Inclusive Single-Cell RNA Sequencing Reveals Heterogeneity in the Type I Interferon Response within Single Cells. 93, (2019).30. B. M. Tang et al., A novel immune biomarker IFI27 discriminates between influenza and bacteria in patients with suspected respiratory infection. Eur Respir J 49,

(2017).31. R. Tiwari, J. C. de la Torre, D. B. McGavern, D. Nayak, Beyond Tethering the Viral Particles: Immunomodulatory Functions of Tetherin (BST-2). DNA Cell Biol 38,

1170-1177 (2019).32. X. Yang et al., Clinical course and outcomes of critically ill patients with SARS-CoV-2 pneumonia in Wuhan, China: a single-centered, retrospective, observational

study. Lancet Respir Med, (2020).33. M. Rodriguez, K. D. Pavelko, M. K. Njenga, W. C. Logan, P. J. Wettstein, The balance between persistent virus infection and immune cells determines demyelination.

J Immunol 157, 5699-5709 (1996).34. S. Tomaselli, F. Galeano, F. Locatelli, A. Gallo, ADARs and the Balance Game between Virus Infection and Innate Immune Cell Response. Curr Issues Mol Biol 17,

37-51 (2015).35. J. Liu et al., The role of porcine reproductive and respiratory syndrome virus infection in immune phenotype and Th1/Th2 balance of dendritic cells. Dev Comp

Immunol 65, 245-252 (2016).

Date post:	18-Jul-2020
Category:	Documents
Upload:	others
View:	0 times
Download:	0 times

SupplementaryMaterialsfor2020/03/15 · SupplementaryMaterialsfor...

Documents